KEGG   Aspergillus clavatus: ACLA_078110Help
Entry
ACLA_078110       CDS       T01148                                 

Definition
(RefSeq) 6-phosphofructokinase alpha subunit
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
act  Aspergillus clavatus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACLA_078110
   01230 Biosynthesis of amino acids
    ACLA_078110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_078110
   00030 Pentose phosphate pathway
    ACLA_078110
   00051 Fructose and mannose metabolism
    ACLA_078110
   00052 Galactose metabolism
    ACLA_078110
  Energy metabolism
   00680 Methane metabolism
    ACLA_078110
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ACLA_078110
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ACLA_078110
Protein phosphatases and associated proteins [BR:act01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ACLA_078110
Messenger RNA biogenesis [BR:act03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ACLA_078110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 792 aa AA seqDB search
MDPAKAPVEPPKRRRIGVLTSGGDAPGMNGVVRAVVRMAIYSDCEAYAVFEGYEGLVHGG
DMIRQLHWEDVRGWLSKGGTLIGSARCMSFRERAGRLKAAKNMILRGIDALVVCGGDGSL
TGADVFRSEWPGLLEELVSHGELTAEQIRPYTVLNIVGLVGSIDNDLSGTDATIGCYSSL
TRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTGADWLFIPEMPPRDGWEDD
MCAMITKNRRERGKRRTIVIVAEGAQDRSLNKISSSTIKDILTQRLGLDTRVTVLGHTQR
GGPACAYDRWLSTLQGMEAVRAVLDMRPESASPVITIRENKIMRTPLMDAVKETKEVAQL
IHEKNFEAAMKLRDAEFKEYHFAYLNTATPDHPKMLVPHHKKMRIAIIHVGAPAGGMNQA
TRAAVAYCLTRGHTPLAIHNGFPGLCRHHDDKPVSSVREVEWLEADAWVNEGGSDIGTNR
SLPSEDIETTAMCFEKYQFDALFVVGGFEAFTAVSQLRQARDKYPAFKIPMVVLPATISN
NVPGTEYSLGSDTCLNTLIEFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLAVGAT
AVYIPEEGIDIKMLSNDIDFLRENFAHDKGANRAGKLILRNECASSTYTTQVIADIFKAE
AHGRFESRAAVPGHFQQGGKPSPMDRIRALRMSIKCMLHLEAFAGKTPDEIAADPMSATV
IGVKGSHVLFSAMGGPDGLEATETDWERRRPKTEFWLELQNYVNVLSGRAEAGKNMWTCY
ESMPPVVHEDSS
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgcaaaagcgcccgtcgaaccccccaagagacgccgcatcggtgtcctcacc
tcgggtggtgatgctcctggtatgaatggagtggtgcgggccgtcgtccgtatggccatc
tactccgactgcgaagcctacgccgtgttcgagggatacgaaggtctggtacatggaggg
gatatgatccgtcagctgcactgggaagacgtgcggggctggctctccaagggtggcaca
ctgatcgggtcggctcgctgcatgtctttccgggaacgcgcgggtcgtctcaaggccgcg
aagaatatgatcctgcggggcatcgacgcgttggtggtctgcggtggtgatggcagtttg
accggtgccgacgtctttcgctcggaatggcctgggctgctggaggaactggtcagccac
ggggaattgacggcggagcagatcaggccgtacacagtgttgaacattgtcggcctggtg
ggttcgatcgacaacgacttgtccggcacagacgccaccatcggctgctattcctcgctc
acccgcatttgcgacgccgttgacgacgttttcgacacagccttttcacaccagcgcggt
ttcgttatcgaggtcatgggtcggcactgcggctggctggccttgatgtccgccatcagc
accggggccgactggctgttcatccccgagatgcctccgcgcgacggatgggaggatgac
atgtgcgccatgattaccaagaaccgcagagaacgcggcaagcgtcgcacgatcgtcatt
gtcgccgaaggtgctcaagaccgcagtctcaacaagatctccagctccaccatcaaagac
atccttacacaacgcctggggctggatacccgtgtcaccgtgctgggacatactcagaga
ggaggaccggcctgcgcatacgaccgctggctgtcgaccctgcagggcatggaggccgtg
cgcgccgtcttggacatgaggccggaatcggcttcgcccgtcatcaccatccgtgagaac
aagatcatgcgcacgcccttgatggacgccgtgaaggaaaccaaggaggtggcgcagctg
atccatgagaagaactttgaggcggccatgaagctgcgtgacgctgagttcaaggagtac
cattttgcctatctcaacaccgccacccccgatcatcccaagatgctcgtcccccatcac
aagaaaatgcgaattgccatcatccacgttggtgcccccgccggcgggatgaaccaggcc
acccgtgcggcggtcgcgtactgcctcacccggggccacacccctctggccatccacaac
ggcttccccggtctgtgccgacaccacgatgataagccggtcagctcagtgcgcgaggtc
gagtggctggaggcggacgcgtgggtcaacgagggcggttcggacattggcaccaaccgc
agcctgccgtccgaggacattgagactacggccatgtgcttcgagaagtaccagttcgac
gcgctgtttgtagtcggtgggttcgaggcgttcacggccgtgagccagctgcggcaggcg
cgcgacaagtacccggcctttaagatccccatggtcgtgctgccggcgacgatctcgaac
aacgtgccgggcacggagtactcgctgggcagcgacacgtgtctcaacacgctgatcgag
ttctgcgacgccatccggcagtcggcatcgtcgtcgcggcgccgggtcttcgtgatcgag
acgcagggcggcaagtccggctacatcgccaccacggcgggtctggcggtgggcgcgacg
gccgtgtacatccctgaggaagggatcgacatcaagatgctgtccaacgacattgacttt
ttgcgggagaactttgcccacgacaagggcgcgaaccgggcgggcaagctaattttgcgt
aacgaatgcgcgtcaagcacgtatacaacacaggtgatcgcggatatcttcaaggcggag
gcgcacgggcggttcgagtcgcgggcggcggtgccgggtcatttccagcagggcggcaag
ccgtcgccgatggaccggatccgggcgctgcgcatgtcgatcaagtgcatgctgcacctg
gaggcgttcgcgggcaagacgccggacgagatcgcggcggacccgatgtcggcgacagtg
atcggcgtcaaggggtcgcacgtgctgttctcggcgatgggcgggcccgacgggctggag
gcgacagagacggattgggaacgccggcgtcccaagactgagttctggctggagctgcaa
aactacgtcaacgttctctcggggcgcgcggaggcgggcaagaacatgtggacgtgctat
gagagtatgcctcctgtcgtgcatgaagattcaagttaa

DBGET integrated database retrieval system