KEGG   Aspergillus clavatus: ACLA_078620Help
Entry
ACLA_078620       CDS       T01148                                 

Definition
glucan 1,4-alpha-glucosidase, putative
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
act  Aspergillus clavatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACLA_078620
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     ACLA_078620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 617 aa AA seqDB search
MRFLSTAVGIASVLGQLAGASPVSDISERSLRLEAFIAKEGLLSYQNILKAIGNTGSNAP
GTAAGLFIASPSLVNPDYFFTWTRDSALTIQGLIEIFLTANNFLGIDYQPLKGHIQDYIS
SQAILQNVTNPSGGLSDGAGLGEPKFEVNLNPYTGAWGRPQRDGPALRAIAMLTYMQHLI
KKGEKSVASDLVWPVVANDLAYVAQYWNSTGFDLWEEVDGSSFFTSAAQHRAMVEASTVA
KALGKPFETYDAIAPQILCFLQTYWNGKNIVSNINTNNGRTGIDLNSVLTSIHMFDPEAG
CDDATFQPCSSKALANHKVYVDSFRSIYTANAGRGKGQPANVGRYPEDVYQGGNPWYLAT
LAAAEQLYDALYVWRKQGSLTVTEISLPFFRDFSDTIKPGTYRANSATYQSLTRAVGNYA
DGFTSLVQESTPRNGSLAEQYTRDTGAPISAGDLTWSYAAFLSAVQRRASIVPGSWGAGR
ANTVPATCKAVTVRGTYAVAKPPFPFSSTKCIPAKRVPVTFWLTASTYWGQNVFMTGNTT
ALGNWNTTAGYALSSALYTEANQLWVASVEELKPGETIEYRFYKVEPDRSITWESTKKRV
YTVPTGCPMSPQLTATW
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcctcagtaccgctgtgggcatcgccagtgtcctcggccaactggccggtgct
tcgcctgtcagtgacatctctgaacgttccctgcgtctcgaggccttcatcgccaaggag
ggactcttgtcgtaccagaacatcctgaaggccattggcaacaccggcagcaatgctccg
ggcacggctgctggtctcttcattgccagcccaagccttgtgaacccagactatttcttc
acatggacccgtgattctgcgttgaccatccagggcctgatcgaaatcttcctgactgcc
aacaacttcctgggaatcgactatcagccgctcaagggccacattcaggactacatctct
tcgcaggccatccttcagaatgtcaccaatccgtctggcggactgtccgatggcgctgga
cttggtgaacccaagttcgaggtcaacttgaacccatacaccggagcctggggccgccct
cagcgggatggtcctgctcttcgggcgattgccatgttgacctacatgcaacacctgatc
aagaagggcgagaagtccgtcgcctccgaccttgtctggcctgtggttgccaacgatctg
gcctacgtcgcgcagtactggaacagcaccgggttcgatctctgggaagaggtcgatggc
tcctcgttcttcacgagcgcggcccagcaccgcgctatggtcgaagccagcaccgtggcc
aaggctctcggcaagccctttgagacctacgacgcgatcgctccccagattctctgcttc
ttgcagacctactggaacggaaagaatatcgtctccaacatcaacacgaacaatggtcgt
accggcatcgacctgaactccgtcctgaccagcattcatatgttcgaccctgaagcgggc
tgtgatgatgctacattccagccctgctcctccaaggccttggccaaccacaaggtctac
gtcgattccttccgctcgatctacacggccaacgctggacgcggcaagggccaacctgcc
aatgtcggtcgttacccggaggatgtctatcagggcggtaacccatggtatcttgctact
ctggctgcggccgagcagttgtacgatgccctctacgtgtggcgcaagcagggatcactc
accgtcaccgagatctcgcttccgttcttccgtgacttctccgacacgatcaagccgggc
acctaccgggccaactcggcgacctaccagtcgctgacccgggccgtcggcaactacgcc
gacggcttcaccagcctcgtgcaggaatccactcctcgcaacggctcgctagcggagcag
tacacgcgcgacacgggcgcgcccatctccgccggcgacctgacctggtcgtacgcggcg
ttcctgtcggcggtgcagcggcgggcctcgatcgtgccggggtcgtggggcgccgggcgc
gccaatacggtgccggccacctgcaaggccgtgacggtgcgcgggacgtacgcggtcgcg
aagccgcccttcccattctcgtcgaccaagtgcatccccgccaagcgcgtgcccgtcacc
ttctggctgacggccagcacgtactggggccagaacgtgttcatgacgggcaacaccacg
gcgctgggcaactggaacacgacggcgggctacgcgctcagctcggcgctgtacacggag
gcgaaccagctgtgggtggcgtcggtggaggagctcaagcccggcgagacgatcgagtac
cgcttctacaaggtcgagcccgaccgctcgatcacctgggagtcgaccaagaagcgggtg
tataccgtcccgactggttgccctatgtctccccagctcacggccacttggtaa

DBGET integrated database retrieval system