KEGG   Aspergillus clavatus: ACLA_080540Help
Entry
ACLA_080540       CDS       T01148                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
act  Aspergillus clavatus
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ACLA_080540
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACLA_080540
   00640 Propanoate metabolism
    ACLA_080540
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ACLA_080540
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    ACLA_080540
Enzymes [BR:act01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ACLA_080540
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ACLA_080540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2293 aa AA seqDB search
MGVPNGSSSNGHVSAAKYNIPSHFIGGNHLDAAPPSSVKDFVANHEGHSVISSVLIANNG
IAAVKEIRSVRKWAYETFGNERAIQFTVMATPEDLRANADYIRMADQYVEVPGGTNNNNY
ANVELIVDVAERMNVHAVWAGWGHASENPRLPESLAASPKKIIFIGPPASAMRSLGDKIS
STIVAQHANVPCIPWSGTGVEDVTIDENGIVTVPDEVYNRGCTFSPQEGLAKAKEIGFPV
MIKASEGGGGKGIRKAEREEDFISLYNAAANEIPGSPIFIMKLAGNARHLEVQLLADQYG
NNISLFGRDCSVQRRHQKIIEEAPVTIAKPVTFQAMERAAVSLGKLVGYVSAGTVEYLYS
HADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPNTS
SEIDFDFSNEESFKTQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGY
FSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKELSIRGDFRTTVEYLIKLLET
PAFEDNTITTGWLDQLISNKLTAERPDPIVAVLCGAVTKAHLASEGGVEEYRKGLEKGQV
PSKDVLKTVFPVDFIYEGARYKFTATRASLDSYHLFINGSKCSVGVRALADGGLLVLLDG
RSHNVYWKEEAAATRLSVDGKTCLLEQENDPTQLRSPSPGKLVKFTVENGEHVKAGQPFA
EVEVMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRVKHAHPFTGQLPEIG
PPQVVGSKPPQRFFLLHSILENILRGYDNQVIMNATLKELVDVLRNPELPYGEWNAQSSA
LHSRMPQKLDAQLQSIVERARSRKAEFPAKQLQKTIARFIEENVNPADAEILRTTLSPLL
HVIDKYMDGLKAHEFNVFIGLLEQYYEVEKLFAGRNIRDEDAILKLREENKEDIGSVVQT
VLSHSRVGAKNNLVLAILAMYRPNQPGVGNVGKYFKPILKKLTELESRSAAKVTLKAREV
LIQCALPSMEERLSQMELILRSSVVESRYGETGWDHREPEFSVLKEVVDSKYTVFDVLPR
FFVHQDPWVTLAALEVYVRRAYRAYTLKGIQYNTSAEVPLLSWDFTFGKLGQPEFGSVNS
AQLSTPSTPTTESSPFRRLNSISDMSYLVNDSSSDPVRKGIIVPVQYLEDAEEVLPKALE
AFPRAGSKKKAGEKGLLADLEGKRRPAPRIETDNELTGVLNIAVRDLEEMDDNQIVAQAS
ALLANFKEELLARRVRRVTFICGKNGSYPSYFTFRGPNYEEDESIRHSEPALAFQLELGR
LSKFKIKPVFTENRNIHVYEAIGKGPENDKAVDKRYFVRAVVRPGRLRDDIPTAEYLISE
ADRLMNDILDALEIIGNNNSDLNHIFINFSPVFNLQPQDVEEALAGFLERFGRRLWRLRV
TGAEIRILCTDPATGMPYPLRVIITNTYGFIIQVELYIEKKSEKGEWILHSIGGTNKLGS
MHLRPVSTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNSWVKAASKIPSLADKR
PPVGECIEYSELVLDDTDNLVEISRGPGTNTHGMVGWIVTARTPEYPQGRRFIIVANDIT
FQIGSFGPQEDNFFHKCTELARKLGIPRIYLSANSGARIGMADELIPYFSVAWNDPHRPE
AGFKYLYLTPEVKKKFDASKKEVITELIHDDGEERHKITTIIGAKDGLGVECLKGSGLIA
GATSRAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGREVYT
SNLQLGGTQIMYKNGVSHMTATDDFEGVQKIVEWMSFVPDKKGAPIPIRPWSDDWDRDVS
YYPPPKQAYDVRWLIAGKEDEEGFLPGLFDAGSFEEALGGWARTVVVGRARLGGIPMGVI
AVETRSVENVTPADPANPDSMELISTEAGGVWYPNSAFKTAQALRDFNNGEQLPVMILAN
WRGFSGGQRDMYNEVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWVVIDPTINPDQM
EMYADEEARGGVLEPEGIVNIKYRRDKQLDTMARLDATYGELRRSLEDPSLSKEQLSEIK
AKMAAREEQLLPVYLQIALQFADLHDRAGRMIAKDTIRKALTWKNARRFFYWRLRRRLSE
ELIVKRMVTVAPTPVPGDASGALPTTTPGNDQPTSTASSTESPRANHLRALHAWTGLLDD
ELEHDDRKVAMWYEENRKAIQTKIEALKTDSVANQISQLLIGNKEGGLKGVQQVLSMLPV
EEKEAVLKYLASA
NT seq 6882 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtccccaacggaagttcgagcaacggccacgttagcgcagccaaatacaacatc
ccctcacatttcatcggtggaaaccacctggacgcggctcctcccagcagtgtaaaggat
ttcgtcgccaatcatgaaggtcactcagtcatcagctcggttctcatcgccaacaacggt
attgccgccgtcaaggagattcgatcggtccggaaatgggcctacgaaacattcggcaac
gagcgtgccattcagttcacggtcatggccacaccagaagatttgcgggcaaatgcggac
tacatccgtatggctgatcaatatgtcgaggtaccgggaggcacaaataacaacaactat
gcgaacgtcgagttgatcgtcgacgtggctgagcgaatgaacgttcatgctgtctgggcc
ggttggggtcacgcctccgaaaaccccagactccccgagtctctggctgcttcgcccaag
aagatcattttcatcggcccccccgcctcggctatgcgttctttgggtgacaagatctcc
tccacgattgttgcacagcatgccaacgtcccttgcattccgtggtcaggcacaggcgtg
gaggacgtgacaattgacgagaacggaattgtcaccgttcccgatgaggtctacaaccgc
ggctgcactttctctcctcaggaaggtctggcgaaagccaaggagattggtttcccagtc
atgatcaaggcttcggaaggtggtggtggtaaaggtatccgcaaggccgagcgggaggaa
gattttatcagcctgtacaatgccgccgccaacgaaatccccggctctccgatcttcatc
atgaagctggcaggcaacgccagacatctggaagtccagctgctggcagatcagtacggc
aacaacatttccctattcggccgtgattgctccgtccagcgtcgtcaccagaagattatt
gaagaggcccccgtcactattgccaaacccgtcaccttccaagccatggagcgcgcggcc
gtcagcctgggcaagctggtcggttacgtctctgccggtaccgtcgagtacctgtactcg
cacgccgatgacaagttctacttcctcgagttgaatcctcgtcttcaggttgagcacccc
accaccgagatggtttccggtgtcaatctgcctgccgcccagctccagattgccatgggt
atccctctgcaccgtattcgcgacatccgtctgctctacggtgtggatcccaacacgtct
tctgaaatcgattttgacttctccaacgaggagagcttcaagacccagcgccgccctcag
cccaagggacataccactgcctgtcgtatcacctctgaggaccctggtgaaggattcaag
ccctccagcggtacgatgcacgaactgaacttccgcagctcttccaacgtctggggttac
ttctccgtcggtaccgccggtggtatccacagtttctccgacagccagttcggtcacatc
ttcgcctatggcgagaaccgttccgcctctcggaaacacatggttgttgcgttgaaggag
ttgagcatccgtggtgatttccgcaccacagtcgagtacctgatcaagttgctcgagact
cccgccttcgaagacaacaccatcaccaccggctggttggatcagctgatctccaacaag
ctaactgcggagcgtcccgatcccatcgtggccgtgctctgcggtgcggtgaccaaggct
catttggccagcgaaggcggcgttgaggagtaccgcaagggtctcgagaagggtcaggtc
ccctccaaggatgtcctcaagaccgtctttccagtggacttcatctacgaaggcgcgcgg
tacaagttcaccgccacaagggccagcttggacagctatcacctgttcatcaacggctct
aagtgctctgttggtgtgcgtgcgttggctgacggtggtttgctcgttctgttggacggc
cgtagtcacaacgtctactggaaggaggaagctgcggcgacccgcctcagtgtcgatggc
aagacgtgcctgctggagcaggagaatgaccccacgcaactccgttcgccttcacctgga
aagctggtcaaattcaccgtcgagaacggtgagcatgtcaaggccggccagcctttcgcc
gaggtcgaggttatgaagatgtacatgcccttgatcgcgcaggaagacggtatcgtgcag
ctcatcaagcagcccggtgccactctggaggctggtgacattctgggtatcttggctctg
gatgatccctctcgcgtcaagcacgcgcaccctttcactggtcagctgcccgagattggt
cctcctcaggtggtcggcagcaagcctcctcagagattcttcctcctacacagcatcctt
gagaacatccttcgcggatacgacaaccaggtcatcatgaatgccacgctcaaggaactg
gttgacgttctgcgcaaccctgagctgccctacggcgaatggaacgcgcaatcctcggct
ctgcattcccgcatgccccagaaactggatgctcagctgcagagcatcgttgagcgggcg
cgctcccgcaaggccgaattcccagccaagcagctgcagaagaccattgcccgattcatc
gaggagaatgtcaaccctgccgatgccgagatcctccgaaccacactttcgcctttgctc
catgtcattgataagtacatggacggcttgaaggcgcatgagttcaatgtcttcattggt
ctgctggagcagtactatgaggtcgagaagctgttcgccggacgtaacatccgtgacgaa
gatgccatcctgaagctcagagaggagaacaaggaggacattggcagcgttgtgcagacc
gttctgtcccatagccgtgttggcgcgaagaacaacctggtcttggccatcttggccatg
taccgccccaatcagcccggtgttggcaacgtcggaaagtacttcaaacccatcctgaag
aagctcacggaactcgagtcgcgctctgcggccaaggtcaccctcaaggctcgtgaggtt
ctcatccagtgtgccctcccatctatggaggagcgcctgtctcagatggagcttatcctc
cgctcctccgtcgtcgagtctcggtacggagaaaccggctgggatcatcgggagccagag
ttctccgtcctgaaggaagtggttgactctaagtacaccgtcttcgacgtcttgccccgc
ttcttcgtccaccaggatccctgggtcactctggctgctctcgaggtctacgtgcgccgc
gcctacagggcctataccctcaagggtatccaatacaacacctctgcagaggtgcccctg
ctgtcttgggacttcactttcggcaagctcggtcagccagagttcggctccgtcaactct
gctcagctgtcgactcctagcacaccgaccaccgagtccagccccttccgcaggctcaac
tccatcagtgatatgtcctacctggtcaatgacagcagcagcgaccctgtcagaaagggt
atcattgtccccgtccagtacctggaggatgctgaggaggtgctgcccaaggctctcgag
gcgttcccgcgtgccggttcgaagaagaaggccggtgaaaagggccttctcgccgatctg
gagggcaagcgccgccccgctcctcgcattgagaccgacaatgagttgaccggcgtgctc
aacatcgctgttcgtgacctcgaggaaatggatgacaaccagattgttgcccaggccagc
gctctgctggccaacttcaaggaggagctgcttgctcgtcgtgtccgccgcgtcaccttt
atctgtggcaagaacggaagctaccccagctacttcaccttccgaggacctaactacgaa
gaagatgagagcatccgtcacagcgagcccgccctggctttccagctggaactcggccgt
ctgtctaaatttaaaatcaagcccgttttcacggagaaccgcaatatccatgtctacgag
gccatcggtaagggtcccgagaacgacaaggctgtcgacaagcgttacttcgtccgtgcc
gtggtgcgccccggtcgtctccgtgatgacatccctactgccgagtacctgatctccgag
gccgatcgcctcatgaacgacatcctggacgccctcgagatcattggcaacaacaactcc
gatctcaaccacatcttcatcaacttctcccccgttttcaacctgcagccccaggacgtg
gaggaggccttggctggtttcctcgagcgcttcggtcgccgtctgtggcgtctccgtgtc
accggtgctgaaatccgcatcctctgcacggatcctgccactggcatgccctaccctctg
cgtgtgatcatcaccaacacctatggcttcatcatccaggtggagctgtacattgagaag
aagtccgagaagggcgaatggatcctccacagcattggcggtaccaacaagctcggctct
atgcatctgcgccccgtctccaccccgtatccgaccaaggagtggctccagcccaagcgt
tacaaggctcatctcatgggcacacagtacgtctatgatttccctgagctgttccgtcaa
gctttccagaacagctgggtcaaggctgcctccaagattccctctttggccgacaagcgc
cccccggtcggcgagtgcatcgagtacagcgagcttgttttggatgacaccgataacctg
gttgagatctcgagaggccccggtaccaacactcacggtatggttggttggattgtgact
gctcgcactcctgagtaccctcaaggcagacgattcatcatcgtggccaacgacatcacc
ttccagattggttccttcggtccccaggaagacaacttcttccacaagtgtactgaattg
gccagaaagcttggtattccccgtatctacctttctgccaactctggagcccgtatcggt
atggccgatgagctgatcccctacttctctgtggcctggaacgatccccacagacccgag
gcaggcttcaaatatctgtacctgacgcccgaggttaagaagaagttcgatgctagcaag
aaggaggtcatcacggagctgattcacgacgatggtgaggagcgccacaagatcaccacc
atcattggtgccaaggacggcttgggtgtcgagtgtcttaagggctccggtctgattgct
ggtgccacctcccgcgcctacgaggacatcttcaccatcaccctggtaacctgccgctcc
gtcggtattggtgcctacctggtccgcctcggccagcgcgccatccaggtcgagggccag
cctattatcctgactggtgcacctgccattaacaagctgctaggtcgtgaggtttacacc
tccaacctgcagcttggtggcactcagatcatgtacaagaacggtgtctcccacatgact
gccaccgacgacttcgaaggtgtgcagaagattgttgagtggatgtccttcgttcctgac
aagaagggtgcccctatccccatccgcccctggtctgatgactgggaccgcgatgtttcc
tactacccaccccccaagcaggcctacgatgtacgctggctcatcgctggtaaggaagat
gaggaaggcttccttcccggtctgttcgatgccggatccttcgaggaggctctcggtggc
tgggcccgtaccgttgtcgttggtcgcgctcgcctcggtggcatccccatgggtgtcatt
gctgtcgagactcgctccgtcgagaacgtcacgcctgccgaccctgcgaaccccgattcc
atggagctgatcagcaccgaggccggtggtgtgtggtaccccaactccgccttcaagact
gctcaggccctccgtgacttcaacaacggtgagcagctgcccgttatgatactggccaat
tggagaggtttctctggtggacaacgtgacatgtacaacgaagttctcaagtacggatct
tacatcgtcgatgcgctggtcaagtatgagcagcctattttcgtctacatccctcctttc
ggtgaactccgaggtggatcttgggtcgtcattgatcccaccatcaacccggaccagatg
gagatgtatgccgatgaggaggctcgcggtggtgttctcgaacccgaaggtatcgtcaac
atcaagtaccgccgcgacaagcagctggacaccatggctcgcctggacgccacctacggc
gagctgcgccgctcgctggaggacccctcgctcagcaaggagcagctgtcggagatcaag
gccaagatggccgcgcgtgaggagcagctcctccctgtgtacctgcagattgcccttcag
ttcgccgacctccacgaccgcgccggccgcatgatcgccaaggacaccatccgcaaggcc
ctgacctggaagaacgcccgtcgcttcttctactggcgtctgcgccgccgtttgagcgag
gagcttatcgtcaagcgcatggttaccgtcgccccgacccccgtccccggcgacgcctct
ggcgccctccccaccaccacccccggaaacgaccaacccacttccaccgcctcctccacc
gagagcccccgcgctaaccacctgcgcgccctgcacgcctggaccggcctgttggacgac
gagctcgagcacgatgaccgtaaggtcgccatgtggtacgaggagaaccgcaaggccatc
cagaccaagatcgaggccctcaagaccgactctgtcgccaaccagatctcccagctcctc
attggcaacaaggagggcggtctcaagggcgtccagcaggtgctcagcatgctgcccgtc
gaggagaaggaggccgtgctcaagtatcttgcctcggcttga

DBGET integrated database retrieval system