KEGG   Aspergillus clavatus: ACLA_082200Help
Entry
ACLA_082200       CDS       T01148                                 

Definition
glycerol kinase, putative
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
act  Aspergillus clavatus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ACLA_082200
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ACLA_082200
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACLA_082200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 596 aa AA seqDB search
MQPADIFVGSIDQGTTSSRFLIFNRDGEPVASHQVEFTQIYPNPGWHEHDPLELVSSVET
CIEEAVKQFESTGYSQYSIKGIGITNQRETTVVWDHETGEPLYNAIVWTDTRSQTIVHEL
KQKWEASQLQQICGLPLSTYSSSSKLLWMLSNVPKVKDAYQRGTLAFGTVDAWLVYRLNG
GAAANVFVSDPTNASRTMFMNLETLQYDNFLLDFFGIRGRVHLPKIVPSSDTKAYGKLAS
GILAGVSIMGCLGDQSSALVGQKRFSPGMAKNTYGTGCFLLYNVGDKPVISKHGLLATVA
YHFDGKAVYALEGSIAVAGSGIKFLQNNLNFFGDSKEVNDLAMTVEDNGGCVFVTAFSGL
FAPYWIDDAKGTMFGITQYTQKGHIARATLEATCFQTKAILDAMEKDSGHALSELAVDGG
VSNSDLAMQIQADLISIPVYRPKMRETTALGAAIAAGLAVGMWRNFAELRDINRAGGAVF
EPKISREASAQSFSRWEKAVGMSKGWVGGEQVPPVQAVQPIPKESKEDAPEVGTNHTTMK
VAPAKLNGEIVPPKVPLISISGDLDDADEEELYLELRKVEILQRLKKLRKLKISFF
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccgcagatattttcgtaggatccattgatcagggcaccaccagctcccgattt
ctgatcttcaatcgagacggtgagcccgtggcctcccaccaagtcgaattcacacagatc
tatcccaatccagggtggcatgagcacgatccactggagctcgtttcgtccgttgagacc
tgcattgaggaggcggtcaaacagttcgaatcgacaggctactcccagtacagcatcaag
gggatcggtatcacaaaccagcgggaaacgaccgtcgtttgggaccatgagactggcgag
cctctttacaacgccatcgtctggactgatacccgctcacagaccatcgtacacgagctc
aaacagaaatgggaagcatcgcaactacagcagatctgcggtctccctctctccacctat
tcctcgtcttcaaaacttctgtggatgctatccaacgtcccaaaagtgaaagatgcatac
cagcgaggcacgttagcatttggaacggtggacgcatggcttgtgtaccgtttgaatggt
ggagcagcagcaaacgtgttcgtatccgatcctacaaacgcctcacggacgatgttcatg
aatcttgagactctgcaatacgacaacttccttctggacttctttggtattagaggaagg
gtccatctacccaagattgtgccttcctcagacaccaaggcctacggaaaattggcatct
ggaatcctcgctggcgtttccatcatgggctgtctcggtgaccagtcgtcggcacttgtc
ggtcagaagcgattctcaccgggcatggcaaagaacacttacggaacagggtgtttcctc
ctctacaacgtcggcgacaagccagtcatttcgaagcatggtctgctagccactgtcgct
tatcatttcgatggtaaagcagtgtatgctcttgagggcagcattgcggttgccggatct
ggcatcaagtttctacaaaataacctcaacttcttcggggattccaaggaggtgaatgat
cttgccatgacggtcgaggataacggcggctgtgtgtttgtcacggctttcagtggtctt
tttgcgccgtactggattgacgatgcgaagggaacgatgtttgggattacacagtacact
cagaaggggcatatcgcacgagcaacgctggaggctacttgcttccaaaccaaagctatt
ctagatgcaatggagaaagatagcgggcacgcgctctcggaactggccgttgacggcggt
gttagcaattcagatctggctatgcagattcaagcagacctgatttcaattccggtgtac
cgccccaagatgcgcgaaactacagcactaggtgccgcaatagctgctggactcgcggtt
ggaatgtggagaaacttcgccgagctgcgggatattaatcgtgctggaggcgccgtcttt
gagcccaagattagccgggaagcaagcgctcagtctttctcccggtgggagaaggctgtc
ggaatgtccaagggctgggtcggaggcgagcaagtgcctcccgtgcaagccgtgcaacct
attccaaaggaaagcaaggaagacgcccccgaggttggaacgaatcacaccaccatgaag
gttgcgccggcgaagcttaacggagagatcgtgccacccaaggttcccttgattagtata
tccggggacctagacgatgccgacgaggaggagttgtatctggagctccggaaggtggaa
atcttacagcggctcaagaaacttcgaaaactcaagatttcctttttctga

DBGET integrated database retrieval system