KEGG   Aspergillus clavatus: ACLA_082230Help
Entry
ACLA_082230       CDS       T01148                                 

Definition
protoporphyrinogen oxidase, putative
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
act  Aspergillus clavatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACLA_082230
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ACLA_082230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 600 aa AA seqDB search
MRLPCAPSRALRAVRTPLAFARNGQWHSLHTGTYNAAVIGGGITGLTTAFRLTQDPACSK
IALFEEAPEVGGWMSSSVVKDPAGNQVVFEDGPRTLRAVAPACLPLLDLLVELDLLDDVL
ITSKTSPAATNRFIYYPDHLVRLPTPDPRSGFFGHAFELIRTVFTEPLFENAVWNILSEP
LKPRPERRPQDESLAEFWSRRLSPEVADNLVSPVFHGIFAGDIDRLSAQYLMGAAREMEN
HERRVIGGYLDTMSSGVKYMVMDDLLALHSLSKTKQKAYWRSLQTLIRGASVLTFKNGTQ
QLAHRLAEVLRQSNKVRLLTGTEVTAISQNPDTSDLTVHYGENKSESYNRIIATNPAPDL
AEKLAKPIRPGQQLPQNSIRHLKEHNYAVTVAVVNLFFETPDLLPVQGFGYLIPRSIPYE
QNPERALGVIFGSETSIGQDTRDGTKVTVMMGGHWWDGWKESDYPSTEASIAMARDVLAR
HLNITEEPILVGANLKKNAIPQYTVGHLSRMEELSEAVRHDFKNRLTLAGNWYNGIGVTD
CIRQGYMAASYGVGAMKLDAPNRNVPWVRHNWENWDLEGGIPMSPVRWTDTFASERSQFY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgccatgtgctcctagccgtgcactcagagcagtccggacgccattggcgttc
gctcgcaatggccagtggcactcgctgcataccggcacttataatgctgcggtcatagga
ggtggtatcacaggcctaacaacagctttccgcctaacacaggacccagcatgttccaaa
atcgcactctttgaggaagcccctgaagtaggggggtggatgagctcttcagtagtcaaa
gatcctgctgggaaccaggtcgtcttcgaagacgggccgcggaccttgcgggctgtggca
cctgcgtgtcttccgcttcttgacttgctagtcgagctcgatttactagacgatgtactc
ataaccagcaaaacctccccggccgccacgaaccgtttcatatactacccagatcacctt
gttcgcctaccgacccctgatccccggagcggtttcttcgggcacgctttcgaattaatt
aggacggtgttcacggaaccccttttcgagaacgcagtgtggaatatcctctcggagccg
ttgaagccgcgcccggagcgcaggcctcaggatgaatccctcgcggaattttggtcacgg
cggctgtcccccgaagtcgcggataacctggtgtctccagtattccatggcatttttgcg
ggtgatattgaccgtctgagcgctcagtacttgatgggagcagctcgggaaatggaaaac
catgaacgtcgcgtgatcgggggctacttggacaccatgtcatcgggagtcaaatacatg
gtgatggatgacctgctggctttgcattcgctgtcgaagactaagcagaaggcatactgg
aggagtctccagacgttgatcaggggggctagtgtcttgacgttcaagaatgggacgcaa
cagcttgctcatcgtttggctgaggtgttgcgccagtctaacaaagtacggttattaact
ggcaccgaggtgacggccatcagccagaatccggatacttctgacttgaccgtccactat
ggagaaaacaagtctgaatcctacaaccgtatcattgctacaaacccggcccccgatctc
gcagagaaattggccaagcctatcaggccgggacagcaactcccgcaaaactcgatacgc
cacttgaaggagcacaattacgctgtgacggtggcagtcgttaacctcttctttgagacg
cctgacctactccccgttcagggtttcggatacctgatcccgcggtccatcccatacgaa
cagaatcccgaaagggcgctgggcgtgatctttgggtctgagaccagtataggccaagat
acgagagacggcacaaaggtcacggtgatgatgggcggtcattggtgggacggctggaag
gaatccgactatccctccaccgaagcctccattgccatggcccgtgacgtactcgcaaga
catcttaacatcaccgaggaacctatattggttggggcaaatttgaagaagaatgccatt
ccacagtacaccgtggggcacctgtcgcgcatggaggaattatcagaagctgtccgccat
gacttcaagaaccggctgactctggctggaaattggtacaatggcatcggggtgacggac
tgtattcggcaaggatacatggctgcgtcgtatggcgttggtgcaatgaagctcgacgct
ccgaaccgcaatgtcccgtgggtaaggcataactgggagaattgggatctggagggaggt
attccaatgtcccctgtgcggtggacggatacctttgcatcggagcgcagtcagttctac
tga

DBGET integrated database retrieval system