KEGG   Aspergillus clavatus: ACLA_083330Help
Entry
ACLA_083330       CDS       T01148                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
act  Aspergillus clavatus
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ACLA_083330
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ACLA_083330
Transfer RNA biogenesis [BR:act03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ACLA_083330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MSYQQERYIAELAVQRATLLTQKVFHEKAKGTVSKDDKSPVTIGDFGAQALIIQAIRKNF
PNDEIVAEEEASSLREDKALSAEIWRLVKDIKLEDNESNELLGGSLPSEDAMLDTIDQGK
SAGGPKGRIWALDPIDGTKGFLRGGQYAVCLGLMEDGDVKVGAIGCPNLPVDDSVAMTTS
IGVDQTDGAGKGVLFSAIKGEGAISRPLSNGALAESKPISMRPVPDIKQSVFCEGVEAAH
SAQGDNAAVAQLLGITSPSVRLDSQAKYCSIARGAGDIYLRLPVKKDYQEKIWDHAAGDL
IVREAGGQVTDIYGQRLDFSKGRTLAANKGVVAAPKAIQGEVISAVKTVLKL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccagcaggaacgctacattgccgaactcgcggttcagcgagcaaccctccta
acacagaaggttttccacgagaaggccaagggcaccgtatccaaggacgacaagtcgccc
gtcactatcggcgacttcggcgcccaggccctcatcatccaagcgatccgcaagaacttc
cccaacgatgagattgtcgctgaagaagaggccagttccctccgcgaggacaaggcgctg
agcgctgagatctggagacttgttaaggatatcaagcttgaggataacgagagtaatgag
ctcttgggtggctccttgccaagcgaagatgcgatgctggacaccattgaccaaggcaag
agcgccggcggtcctaagggccgtatctgggctctggaccccattgacggcaccaagggt
ttcctccgcggtggtcagtacgccgtctgtcttgggctgatggaggatggagatgtcaag
gtcggggctatcggttgccccaacctgcctgtcgatgattctgtcgctatgactaccagc
attggtgttgatcagaccgatggcgctggaaagggagtgctcttctcggccatcaagggt
gagggggccattagccgacctctctcgaacggtgctctcgccgaaagcaagccgatctcg
atgcgtcccgtgccagacatcaagcaatccgttttctgcgagggagtggaggctgcccac
tcagcgcaaggtgacaacgccgccgttgctcagctcctcggtatcacctcccccagtgtg
cgtctggattcgcaggccaagtactgctcgatcgccagaggtgctggtgacatctacctg
cgcctccccgtcaagaaagactaccaagagaagatttgggaccatgccgccggtgatctg
attgttcgcgaggccggtgggcaagtgacagacatctatggccaacggttggatttcagc
aagggccggactctggctgccaacaagggcgtcgtcgccgctcccaaggccattcagggt
gaagtcatcagtgcggtcaagactgtcctgaagctataa

DBGET integrated database retrieval system