KEGG   Aspergillus clavatus: ACLA_083700Help
Entry
ACLA_083700       CDS       T01148                                 

Definition
alkaline phosphatase, putative
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
act  Aspergillus clavatus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:act00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 626 aa AA seqDB search
MWYSLSLLLLSASTATASYAGNLNYRSPSFNHPELGVSVRKVAKRSDPASAFDPEKLSFT
HGVASGDPYADSVILWTRCSPTFDDVHDNSTTSGLVPLYNPVPIYSGKKNKPVSNAPVCL
NYKVARDEGMKKVVSEGTAFTSSDIDYTVKVEATKLKPFTTYYYQFNVCNSNKKSPVGRT
KTAPAPKDKVDNINLAVFSCSNYPFGFFNGYGNPVRKDSVDYVLHLGDYIYEYKNGDYGW
GDSIGRISQPDKSIFTLYDYRKRLATYRTDLDLQASHQSFAWIPVWDDHEVSDNTYRDGS
SKLHNEEDSFLTHGGVSVDQRKMNAVRAYFEWMPIRQVDMDDNLRIWRNFQLGSLVDLIM
LDTRQYDRSITDTYDNTDYIYQIADDASRTLMGSRQENWFYRNLIDSSKRGAHWRIIGSQ
IVFSRLNQSIANPEHHLNADAWDGYLANKNRTLQTLYDNQIGNNIMIAGDSHANWVSDVA
WLDNKPYDSKTGAGAIGVEFAGTALTSPSPYGQNISIADANKASKSLVANNEELQWSELY
YRGYFELHITPQEVEARFFGLPNIKERNGGEISLANFTVKSGDNRLERNSNGMVAGGSVV
NGWLKNGRVVPTNQTYDTTTGAYTVL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtggtactccttgtcccttctcctgttgtccgcctcgacagctacggcgtcgtatgcg
ggtaacctcaactaccgcagcccctccttcaaccatcctgagctgggagtctctgtccgt
aaggttgcgaagcgaagcgacccagcctcggcctttgaccccgagaagctgagctttact
cacggtgtggcatccggtgatccatacgctgactctgtcatcttgtggacacgttgttct
cccaccttcgacgatgtccatgacaacagcaccacgtctggcctcgtgcccttgtataac
cctgtgcccatctattcgggcaaaaagaacaagccggtttctaatgctcctgtctgtttg
aactacaaggttgcgcgtgatgagggcatgaagaaggttgtctcggaggggacggcgttc
accagttcggatatcgactatactgtcaaggtcgaggcaaccaaactgaagccatttacc
acttactactaccagttcaatgtctgcaattcgaacaagaagagccctgttggacgcacc
aagactgctcctgcgcccaaggacaaggtcgataacatcaatctggctgtgttctcttgc
agcaactacccattcggattcttcaatggttacggtaaccctgtccgaaaagactctgtc
gattacgttctgcacctaggcgactatatctacgagtacaagaacggcgattatggctgg
ggagacagtatcggacgcatctctcaaccggataaatcaatcttcacgctttatgattat
cgcaagcgcttggccacctatagaaccgatctggatctgcaggcaagccaccagagcttc
gcctggattccagtttgggacgatcatgaggtgtctgacaatacctaccgggacggatct
tccaagctccataatgaggaggactccttcctaacacacggcggagtatccgtggaccag
cgcaagatgaatgccgtgcgcgcttattttgagtggatgcctatcagacaagtcgatatg
gacgacaaccttcgtatttggaggaacttccagcttggttccctggttgacctgatcatg
ctggacaccagacagtatgaccgctcgatcactgacacatacgataatacagactatatc
taccagatcgcggacgatgctagtcggactttgatgggcagccggcaggagaactggttc
taccgcaacctcattgactcatccaagaggggagcccactggcgcatcatcggtagtcaa
attgtcttctctcggctcaaccagtcgattgccaatcccgaacaccacctgaatgccgat
gcctgggatggctatctggccaacaaaaaccgcactctccagacgctgtatgacaaccag
attggcaacaatatcatgattgccggggactctcatgccaactgggtgagtgacgtggct
tggctcgataataagccctacgactctaagaccggagccggtgctattggtgtcgagttc
gcgggaaccgctctcacgtcgccgtccccttacggacagaacatttccattgccgatgcc
aacaaggcgtcaaagtctctggtcgcaaacaatgaggagcttcagtggtccgagttatat
taccgcggttactttgagcttcacatcactccccaggaggtggaagcccgcttcttcggt
cttcccaacatcaaggagcgcaacggcggtgagatctcgcttgccaatttcactgtcaag
agcggcgataatcgactagagcgcaactccaacggtatggtggccggaggctccgtggtc
aatggatggctcaagaatgggcgggtggtcccgactaatcagacctacgataccactacc
ggtgcttacacagtactatga

DBGET integrated database retrieval system