KEGG   Aspergillus clavatus: ACLA_084070Help
Entry
ACLA_084070       CDS       T01148                                 

Definition
ceramide synthase membrane component (LAG1), putative
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
act  Aspergillus clavatus
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ACLA_084070
Enzymes [BR:act01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     ACLA_084070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 445 aa AA seqDB search
MGRARKSSHLGEDIRGDTSAPAMSTMNEVSPIEGEAPKWDKLLQTEGAPEKSLKSQSKRR
KVRSLPRRFKNLCLKHTWVLPLLLMSALLLAYAVNPTPDNPLHGAIFLSYPQPPKTPGGP
IMYGKGALDFAFVGFYTIVLSFTREFLMQCVIRPWAAWCGIRGRGKTARFMEQVYTAMYF
AIFGPFGLYVMKQTDIWYFNTTAMFEGFPHREHVGIFKAYYLLQASYWAQQAIVLLLQLE
KPRKDFKELVGHHIITLALIWLSYRFHFTYMGIAVYITHDISDFFLATSKTLNYLDSIIT
APYFGMFVGMWIYLRHVLNLKILWAVLTEFRTVGPYELNWETQQYKCWISQIITFALLAS
LQAVNLFWLFLILRILKNYVFNSIRKDERSEDEDSEEEIEQDAKSQATLATGVEPPSLTA
RKPGKESHTPQVLVNGEPLSTRARS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtgcgcgcaaatccagccatctgggggaggatatccggggggacaccagcgcc
ccggccatgtccaccatgaacgaggtcagccccatcgagggagaggcccctaaatgggac
aagctacttcagaccgagggagcccctgaaaaatctctcaagtcgcagtcgaagcggcgc
aaagtccgatcgcttccccgtcgcttcaaaaatctgtgcctgaaacatacatgggtccta
ccgctgctgttgatgtccgcgctccttctcgcatacgccgtcaacccgactccagacaat
ccgctccatggcgccatcttcttgtcctacccgcaacctcccaagactcctggcggccct
atcatgtatggaaaaggtgccttggacttcgctttcgtcggcttctataccatcgtcttg
tccttcactcgagaattcctgatgcagtgtgtcatccgcccctgggccgcgtggtgtgga
attcgtggcagaggaaagaccgctcggttcatggagcaagtgtacacggcgatgtacttt
gcaattttcggacccttcggcctctacgtcatgaagcagacggatatctggtacttcaac
accacagcgatgtttgaagggtttcctcatcgggaacatgtcggtatctttaaagcctac
tatctcctccaggccagttactgggcccagcaagccattgtgctgctgttgcagctggag
aagccacggaaggatttcaaagagctggtgggacaccacatcatcactctggcgctgatc
tggttgagctaccggtttcacttcacctacatgggcatcgcggtctatatcacgcatgat
atctcggactttttcctggctacttcgaaaaccctcaactacctcgactcgattatcacg
gccccatactttggcatgttcgtcggcatgtggatttacctgcgccacgtgcttaacctg
aagattctctgggctgttctgaccgaattccgcaccgttggcccctacgagctcaactgg
gagacgcagcagtacaagtgctggatcagtcagatcatcaccttcgctctgctcgccagt
ctccaggctgtcaacctcttctggctcttcctcattcttcgcatcctaaagaactacgta
ttcaacagcattagaaaggacgagagaagtgaggatgaagattctgaggaggaaatcgag
caggatgccaagagccaggccaccctcgcgactggcgtggaaccaccctccctcaccgca
cgcaagcctggcaaggagagccatacccctcaggtcctggtcaacggtgaacctctcagc
acaagggctcggtcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system