KEGG   Aspergillus clavatus: ACLA_084290Help
Entry
ACLA_084290       CDS       T01148                                 

Definition
DNA polymerase delta subunit 4, putative
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
act  Aspergillus clavatus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ACLA_084290
   00240 Pyrimidine metabolism
    ACLA_084290
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ACLA_084290
   03410 Base excision repair
    ACLA_084290
   03420 Nucleotide excision repair
    ACLA_084290
   03430 Mismatch repair
    ACLA_084290
   03440 Homologous recombination
    ACLA_084290
DNA repair and recombination proteins [BR:act03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      ACLA_084290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 190 aa AA seqDB search
MPTTRRRGGNTAARSQSTISFGSKSRVTKPSATTRSQKTKDLEPISAAATSTEEVSEPEQ
VPVAPSEPSKPHVAELAVRHQAQKEIQQPLSEEDQRAIKITEQELQRYWQQEEAKRRGPR
VHQEDLSVHEKILRHFDLSSQYGPCIGIARLKRWRRANMLKLNPPIEVLAVLLKEKETVK
QRAYVDELMS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcctactactcgtcgccgcggaggcaacactgccgcccgctcgcagtcaaccatctcc
ttcggttccaagtccagagtcactaaaccatcagccaccacacgctcacagaaaaccaaa
gatcttgagccgatctctgccgctgctacgtcaactgaggaggtctcggagccagagcaa
gttcccgttgctccctcggagccgtcgaagccgcacgttgcggaactcgctgtgagacac
caggcccagaaggagatccaacaacccttgtcggaggaggaccagagggcaattaaaatt
actgagcaagagttgcaacggtattggcagcaggaagaagcgaaacggagaggtcctcga
gttcatcaggaagatctgtcggtacatgagaagatcttaagacattttgatctgtcaagt
caatatggaccatgcattggtatcgctcggctcaagcgctggagacgtgcgaacatgctg
aaactgaaccccccgattgaagtccttgccgtcctattgaaggagaaggagactgtcaaa
cagagggcttatgtcgatgagttgatgtcttga

DBGET integrated database retrieval system