KEGG   Aspergillus clavatus: ACLA_084290Help
Entry
ACLA_084290       CDS       T01148                                 

Definition
DNA polymerase delta subunit 4, putative
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
act  Aspergillus clavatus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:act00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:act00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:act03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:act03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:act03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:act03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:act03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 190 aa AA seqDB search
MPTTRRRGGNTAARSQSTISFGSKSRVTKPSATTRSQKTKDLEPISAAATSTEEVSEPEQ
VPVAPSEPSKPHVAELAVRHQAQKEIQQPLSEEDQRAIKITEQELQRYWQQEEAKRRGPR
VHQEDLSVHEKILRHFDLSSQYGPCIGIARLKRWRRANMLKLNPPIEVLAVLLKEKETVK
QRAYVDELMS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcctactactcgtcgccgcggaggcaacactgccgcccgctcgcagtcaaccatctcc
ttcggttccaagtccagagtcactaaaccatcagccaccacacgctcacagaaaaccaaa
gatcttgagccgatctctgccgctgctacgtcaactgaggaggtctcggagccagagcaa
gttcccgttgctccctcggagccgtcgaagccgcacgttgcggaactcgctgtgagacac
caggcccagaaggagatccaacaacccttgtcggaggaggaccagagggcaattaaaatt
actgagcaagagttgcaacggtattggcagcaggaagaagcgaaacggagaggtcctcga
gttcatcaggaagatctgtcggtacatgagaagatcttaagacattttgatctgtcaagt
caatatggaccatgcattggtatcgctcggctcaagcgctggagacgtgcgaacatgctg
aaactgaaccccccgattgaagtccttgccgtcctattgaaggagaaggagactgtcaaa
cagagggcttatgtcgatgagttgatgtcttga

DBGET integrated database retrieval system