KEGG   Aspergillus clavatus: ACLA_084680Help
Entry
ACLA_084680       CDS       T01148                                 

Definition
NADPH cytochrome P450 reductase (CprA), putative
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     ACLA_084680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 695 aa AA seqDB search
MAQLDTLDLVVLAVLLVGSVAYFTKGTYWAVAKDPYATSGPATNGAAKAGKTRDIVEKME
ETGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADLEDYDYENFDKFPEDKVAFF
VLATYGEGEPTDNAVEFYQFITGDDVAFESGASADDKPLSALKYVTFGLGNNTYEHYNAM
VRQVDIALTKLGAQRIGTAGEGDDGAGTMEEDFLAWKEPMWAALSESMNLQEREAVYEPV
FAVEEEESLSPEDEEVYLGEPTKSHLEGTSKGPYSAHNPYIAPIVESRELFTVKDRNCLH
MEISIAGSNLTYQTGDHIAVWPNNAGMEVDRFLQVFGLEEKRHTVINVKGLDVTAKVPIP
APTTYDAAVRYYMEICAPVSRQFVATLATFAPDEESKAEIVRLGSDKDYFHEKITNQCFN
IAQALQNITPKPFSAVPFSLLIEGLNKLQPRYYSISSSSLVQKDKISITAVVESVRLPGA
SHIVKGVATNYLLALKQKQNGDPSPDPHGLTYAITGPRNKYDGIHVPVHVRHSNFKLPSD
PSKPVIMVGPGTGVAPFRGFIQERAALAEKGENVGLTLLFFGCRNSTEDFLYQDEWKVYQ
EKLGDKLKIVTAFSRETAKKVYVQHRLQEHADLVSELLKQKAIFYVCGDAANMAREVNLV
LGKIIAKSRGLPDDKGEEMVKHMRSSGSYQEDVWS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaactcgacactcttgaccttgttgttctggcagtgctcttggtgggtagcgtt
gcctacttcaccaagggcacttactgggctgttgccaaagacccctatgctacgtctgga
ccagccacgaatggcgctgcaaaggcaggtaaaacccgcgatatcgttgaaaagatggag
gagactggaaagaactgtgtgattttctacggctctcaaaccggaaccgccgaggattac
gcatcccgactggcaaaggaaggttctcagcgctttggcctgaagaccatggtcgctgat
cttgaggactatgactacgagaattttgacaagttccccgaggataaggtcgcgttcttt
gttctggcgacctatggcgagggtgagccgacagacaatgccgtggaattctaccagttc
atcaccggtgacgacgttgctttcgagagtggcgcgtccgccgacgataagcctttgtcc
gcgctcaagtatgtcacttttggtctgggtaacaacacttatgaacactacaatgccatg
gtccgccaggttgatatcgctcttaccaagcttggagcgcaacgtatcggtaccgctggt
gaaggtgacgacggcgctggtacaatggaagaggactttttggcctggaaggaacccatg
tgggctgctctgtccgagtccatgaatctgcaggagcgcgaggctgtttacgaaccggtt
tttgctgtggaggaagaagaatccttgagccccgaggacgaggaggtctatctcggtgag
ccaaccaagagccatctcgaaggtacctccaaaggaccttactctgcgcacaacccttac
atcgcccccatcgtcgaatcccgcgaattgttcactgtcaaagatcgtaactgtcttcac
atggaaatcagtattgccggaagcaacctcacttaccaaaccggcgatcacattgccgtc
tggcctaacaatgctggcatggaagtcgaccgtttcctgcaggtcttcggtcttgaggag
aagcgccataccgtgatcaacgtcaagggccttgatgtgactgccaaggttcccatccca
gctcccactacttacgacgccgctgttcgttactacatggaaatctgtgcccccgtttcg
cgtcagtttgtggctactctggctaccttcgctcccgatgaggaaagcaaggccgagatt
gtgcgcctcggtagcgacaaggattacttccacgagaaaatcaccaaccagtgcttcaac
atcgcccaggctctccagaatatcacaccgaagccgttctccgctgtcccgttctctctg
ctcatcgaaggtctcaacaaacttcagcctcgctactattctatctcctcgtcgtctctc
gtccagaaggataagatcagtatcactgctgtcgttgaatcggttcgcttgcctggtgca
tcccacattgttaagggtgtggccaccaattatctccttgctctgaagcagaagcagaat
ggcgatccatctcccgatcctcatggtttgacttatgctatcaccggtccacgcaataag
tacgacggcatccacgttccagttcatgtccgccactccaacttcaagctgccttctgat
ccctctaagccagtcatcatggttggccccggtactggtgttgctcctttccgtggattc
attcaggaacgtgctgctctggctgagaagggcgagaatgtcggtcttacgcttttgttc
ttcgggtgccgcaacagcaccgaggacttcctgtatcaggatgagtggaaggtctaccaa
gagaaactcggagacaagctcaagatcgtcactgccttctctcgtgaaactgcaaagaag
gtttatgtccagcatagactgcaggagcatgccgatcttgtcagcgaactcctgaagcag
aaagccattttctacgtttgtggcgatgcggcaaacatggcccgtgaggtcaacctcgtc
cttggtaagatcatcgccaagtcgcgtggtctgcctgatgacaagggcgaggagatggtc
aagcatatgcgcagcagtggcagctaccaggaggatgtctggtcatga

DBGET integrated database retrieval system