KEGG   Aspergillus clavatus: ACLA_084790Help
Entry
ACLA_084790       CDS       T01148                                 

Definition
(RefSeq) possible replication factor-a protein
  KO
K10739  
replication factor A2
Organism
act  Aspergillus clavatus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ACLA_084790
   03420 Nucleotide excision repair
    ACLA_084790
   03430 Mismatch repair
    ACLA_084790
   03440 Homologous recombination
    ACLA_084790
DNA replication proteins [BR:act03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    ACLA_084790
DNA repair and recombination proteins [BR:act03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     ACLA_084790
   MMR (mismatch exicision repair)
     ACLA_084790
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     ACLA_084790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MDGGYGYGNSFGGGGGGGGGGGGGFMPGEMNSPAGGKRSNPCPSTAQGTETLISSHNQGD
NNNNTLRPVTVKQALDASQPYPEASFQIDGADVSSVCVVGQVRNISSQSTNVTYKIDDGT
GEIEAKQWIDSQSSDTMETDESKVADTKKPQVELNGYAKVFGKIKSFGNKKYIGAHSVRP
VTDINEVHCHLLEAAAVHLFFTRGPPGGGAAGGAAGDETGADATMGGADDFGNRALPAMS
PVARRVYSLLKTEPQSNEGLHAQLIAAKLNLPMPDVARAGEELLTAGVIFSTVDEQTWAI
LDY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatggtggttatggatatggcaactcgtttggaggaggaggaggcggcggcggcggc
ggtggtggtggcttcatgcccggggagatgaacagtccagccggcggcaagcggtccaac
ccatgcccatcaactgctcaaggaaccgagacactgatctcttcccacaaccagggcgac
aacaacaacaacactctccgtcccgtcacagtcaaacaagccctcgacgcctcgcaaccg
taccccgaagccagtttccagattgacggcgccgacgtatcgagcgtctgcgtggtcggc
caggtccgcaacatcagctcgcagagcaccaacgtcacatacaagatcgacgacggcaca
ggggaaattgaagcgaagcagtggattgattcacagagcagcgacacaatggagacggat
gaaagcaaggtcgccgacacaaagaaaccccaggtggagctcaacggctacgcaaaggtc
ttcggcaagatcaagtcgttcgggaataagaaatacatcggcgcgcactccgtacggccc
gtcacggacattaacgaggtgcactgccacttgctcgaggcggcggcggtccatctgttc
ttcacgcggggacctcctggtggtggagccgctggcggcgctgctggtgatgagacgggt
gctgatgcgacgatgggcggtgccgatgactttggaaacagggctcttcctgcgatgagc
cccgtggcgaggagagtgtatagtctgctgaagacggagccgcagagcaacgaaggtctg
catgctcaactgattgcggcgaagctgaatcttcccatgcccgatgtggcacgggcgggt
gaggagctgctcacggccggtgttatcttttcgactgttgatgagcagacttgggctata
ctggattactag

DBGET integrated database retrieval system