KEGG   Aspergillus clavatus: ACLA_084790Help
Entry
ACLA_084790       CDS       T01148                                 

Definition
possible replication factor-a protein
Orthology
K10739  
replication factor A2
Organism
act  Aspergillus clavatus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ACLA_084790
   03420 Nucleotide excision repair
    ACLA_084790
   03430 Mismatch repair
    ACLA_084790
   03440 Homologous recombination
    ACLA_084790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MDGGYGYGNSFGGGGGGGGGGGGGFMPGEMNSPAGGKRSNPCPSTAQGTETLISSHNQGD
NNNNTLRPVTVKQALDASQPYPEASFQIDGADVSSVCVVGQVRNISSQSTNVTYKIDDGT
GEIEAKQWIDSQSSDTMETDESKVADTKKPQVELNGYAKVFGKIKSFGNKKYIGAHSVRP
VTDINEVHCHLLEAAAVHLFFTRGPPGGGAAGGAAGDETGADATMGGADDFGNRALPAMS
PVARRVYSLLKTEPQSNEGLHAQLIAAKLNLPMPDVARAGEELLTAGVIFSTVDEQTWAI
LDY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggatggtggttatggatatggcaactcgtttggaggaggaggaggcggcggcggcggc
ggtggtggtggcttcatgcccggggagatgaacagtccagccggcggcaagcggtccaac
ccatgcccatcaactgctcaaggaaccgagacactgatctcttcccacaaccagggcgac
aacaacaacaacactctccgtcccgtcacagtcaaacaagccctcgacgcctcgcaaccg
taccccgaagccagtttccagattgacggcgccgacgtatcgagcgtctgcgtggtcggc
caggtccgcaacatcagctcgcagagcaccaacgtcacatacaagatcgacgacggcaca
ggggaaattgaagcgaagcagtggattgattcacagagcagcgacacaatggagacggat
gaaagcaaggtcgccgacacaaagaaaccccaggtggagctcaacggctacgcaaaggtc
ttcggcaagatcaagtcgttcgggaataagaaatacatcggcgcgcactccgtacggccc
gtcacggacattaacgaggtgcactgccacttgctcgaggcggcggcggtccatctgttc
ttcacgcggggacctcctggtggtggagccgctggcggcgctgctggtgatgagacgggt
gctgatgcgacgatgggcggtgccgatgactttggaaacagggctcttcctgcgatgagc
cccgtggcgaggagagtgtatagtctgctgaagacggagccgcagagcaacgaaggtctg
catgctcaactgattgcggcgaagctgaatcttcccatgcccgatgtggcacgggcgggt
gaggagctgctcacggccggtgttatcttttcgactgttgatgagcagacttgggctata
ctggattactag

DBGET integrated database retrieval system