KEGG   Aspergillus clavatus: ACLA_085250Help
Entry
ACLA_085250       CDS       T01148                                 

Definition
cellulase, putative
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
act  Aspergillus clavatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACLA_085250
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ACLA_085250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 394 aa AA seqDB search
MKTTTLVAALLPLVLAAPNTKRSSGFVWFGANESGAEFGESNLPGILGKDYIWPSASTIR
TLHDGGMNVFRVAFRMERLIPNKMTGSPDGTYMNDLRSTVEAITSLGAYAVIDPHNYGRY
YGNIITSTDDFAAFWKTLASEFASNDHVIFDTNNEYNTMDQTLVLNLNQAAINAIRASGA
TSQYIFVEGNSWSGAWTWTDINDNMKALTDPQDKIVYEMHQYLDSDGSGTSPSCVSSTIG
KERMVAATQWLKDNNKKGFLGEFAGGPNDVCKSAVTGMLDYMSLNTDVWMGAEWWAAGPW
WADYMFSMEPPSGTGYQNYFNLLKPYFSTSSSSPSPSTTTTTKATTTTTTAAGPTGTGVA
QPWAQCGGSGYSGPTQCAAPYTCTKQNDWYSQCL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgactactcttgttgctgcgcttctgcctctggtgctggcggcgccgaatacc
aagcgctcgtctgggtttgtctggttcggtgccaatgagtctggcgctgagtttggcgag
agcaatctccctggcatcctcggcaaagactacatctggcccagtgcgtcgaccatccgg
acgctgcacgatggtggcatgaacgtcttccgtgtagccttccgcatggagcgattgatc
ccgaacaagatgactgggtctccggatggcacctacatgaatgatctgagatcgaccgtt
gaagcaatcaccagcttgggagcatatgctgtgattgacccccataactacggaagatac
tatggcaacatcatcacgtcgaccgacgactttgccgcgttctggaagaccctggcatcc
gagttcgcgtccaacgaccatgtcatcttcgacaccaacaacgagtacaacacgatggac
cagaccctcgtcctcaacctcaaccaggccgccataaacgccatccgtgcttccggtgcc
acctcgcagtatatcttcgtcgagggcaactcgtggtccggcgcctggacctggaccgac
atcaacgacaacatgaaggccctcaccgatccccaggataagatcgtgtacgagatgcac
cagtacctcgactccgacggctccggcacctcgcccagctgcgtgagctcgaccatcggc
aaggagcgcatggtggctgctacccagtggctcaaggataacaacaagaagggcttcctg
ggcgagtttgccggcgggcccaacgatgtctgcaagagcgccgtcacgggcatgctggac
tacatgtcgctcaacacggatgtctggatgggcgccgagtggtgggctgccggcccctgg
tgggcagactacatgttcagcatggagccgccatccggcactggctaccagaactatttc
aatctgctgaagccttacttctctacctcctcctcctccccctccccctccaccaccacc
actaccaaggcgactaccaccactaccactgccgcgggtcctaccggcaccggggtcgcc
cagccctgggctcagtgcggcggtagtggctacagcggtccgacacagtgcgcggcgccg
tacacttgcacgaagcagaatgactggtactcgcagtgcctgtag

DBGET integrated database retrieval system