KEGG   Aspergillus clavatus: ACLA_085510Help
Entry
ACLA_085510       CDS       T01148                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ACLA_085510
Peptidases [BR:act01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ACLA_085510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1300 aa AA seqDB search
MSSSVRSGKTAPRLAQDIYDYDPVHPPGTGRNLLSEVPPVFAERQTGSLEFISPSACRHQ
YVTKPNQSFLPQAEQKKSTGNPSKVSAICTECRYHLQLVVSSSPGIGQSTQGFADHIHHL
VYKSGRQRNGVSPAEVTPKGQIVETFHYECSYLTCPVSVSVRIASPVLAEEWVRLLIDPE
VLGRRADEAIAAQPERLEGIGRPLPITVLENLHTYIFNALHDSQRSKSISAVNKRFMTCF
GVEGRPCKSLLEFLGFSVKNEGFWEPPRPNPWAEYPYQDQLKIFLDDVLHELSALIEQRP
ATEKKGRQPPKPPHPSFDDLLYAMDALDYPKSLRSNEFQMAPAPYYEDLGVVEDMSSSSV
VEAFNRQVSVDPARSSLYLQCLKSIGNLRGSDDAQVIDTAVQVAYAEGRYTDEDVIEAYR
YFGLAHDDPHLTEDSIIGKFYAFMSSTTQENESRMRLWRIGDSRRSERIKSAAEDRVATV
EQAQVFLGVDSSTSDEFVLTMYTTKVNDNPASRDIARRAVELIAESRKSAVLTHFVRTGE
MTAGEMDVADAYRLLQIPDRTVDDAAIMAAYTICVDEAPGQAEKYNQALTIIAKDKNSSL
LSSMISGPDADSGRDLSEWPVGLQNIGNTCYLNSLLQFYFSIRPFREMVLDYESFRMELD
DESLSKKHVGSRKVLKKEVERSQTFLRELRTLFQDMITSSRSFVTPGQELARLTLISPSN
EAAIRRRSTISMSRPGGLGEVNGMPIMGPLGPPQLAPEPERSQNPVDAEKEKPKHPTISD
VDSEATLVSDSVKLGTPLLPEDKENETPSKDIVMSEVQPEPASQNNEDNISPKDETPAIP
FGPPNQPPPVPPRSTVPIDPQKQLLEEVEIGAQQDVTEVINNVLFQSQCAIKPIAFAPDG
EQLDQVKDLFYGRSKSYILAEAGTRSKEEWWCDIKVDVATGSRDIYAAIDGAFDAQKVNV
DNTIVEQYSAISKLPPVLQIQVQRVQFDPIKKSSFKSTHHLELKEKIYLDRYMDTQHPEI
MNRRRQCWEWKNTLKTLEERRAELLRQSENDGLDMATLFESAKSVVEDLNSFKDNPETAE
EAIDINPQLSSELGQLSQIVKAELNYVEQEIKNTQTLISSQFVDFKHLAYRLYAVFVHHG
SVEFGHYYIYIFDFRKNVWRKYNDNEVTEVQNPDEIFKNQERQNPPTPYFLVYVNDALKD
RLVDPVCRQIIDNMAHSEPVSGTEPTLPMEGVTTTTPVPQEDLNMDSPAYDEAFADNYTS
GTGAALRVEKDRKGPVDVGSKAPTSSWPSNNLADQRDVEW
NT seq 3903 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctcagtacggtctggcaaaactgccccgcggctcgctcaagacatttacgat
tacgatcccgtacacccgccaggcacaggccgcaatcttctttcagaagtccctccggtc
ttcgctgaacgacaaaccgggtcactcgaattcatttcgccttccgcatgtcgccatcag
tatgtgaccaaaccgaaccagagcttcctccctcaggcggaacagaaaaaaagcaccggg
aatccctcgaaggtttcggcgatttgcacagagtgtcgataccatcttcaactcgttgtt
agctccagcccaggcataggccaatcaacgcaagggtttgcggatcacatacaccatttg
gtttacaagtctgggaggcagaggaatggtgtttctccagcggaagtcactcctaagggt
cagatcgtcgagacattccactacgaatgctcctacctcacatgtcctgtatcggtctcg
gtgcggatcgcatcgcctgtcctcgccgaggagtgggtgcgacttctgattgaccccgaa
gtgctggggaggcgtgcagacgaagcgatcgcggcacagccggagcgtctggaaggcatc
ggtcgaccactgccgatcacggtgttggagaacctacacacttatatcttcaacgctctc
catgatagccaacggagcaagtcgatatcagctgtgaacaaaaggttcatgacatgtttc
ggcgtcgagggccgaccctgcaaaagcctcctggaattccttgggttctctgtgaagaat
gaaggattttgggagcctcctcggcctaatccatgggcggaatacccctatcaggaccag
ctgaagatcttccttgacgatgtcctacatgagctttctgcactcattgagcagcgtccg
gcgacggaaaagaaaggtcgccaaccgccaaaacctcctcatccttcgtttgatgatcta
ctgtatgcgatggatgcattggactatcccaaatctctacgatccaatgaattccagatg
gcccctgcaccttattacgaagatctgggtgtcgttgaagatatgtcatcctcttcggtc
gttgaagcattcaaccggcaagtttcagttgatccagcaagatcatcactttatctacag
tgtctcaaatccatcggcaatttaagaggcagcgatgatgcccaagtcatagacacggcg
gttcaggtggcttacgctgagggcagatacacggacgaagatgtaatcgaggcctacaga
tatttcggacttgctcacgatgatccccatctcaccgaagatagtattatcgggaagttc
tatgcctttatgagctccacgacacaagaaaatgaatctcgcatgagattatggagaatc
ggggatagcaggaggagtgagcggatcaaatcagcagcggaagatagagtcgcaaccgtc
gaacaagcacaggtattccttggcgttgacagttcgacaagcgatgagtttgttctgact
atgtataccacgaaggtcaatgacaacccagcaagcagggatattgctcggcgtgctgtt
gagctcattgctgaatctcgaaaatcggccgttttaacacattttgttcgcaccggtgaa
atgaccgctggtgaaatggatgttgctgatgcctatcgtttgcttcaaatccctgatcgc
acagtggatgacgccgccatcatggcagcatacaccatctgtgtggacgaagccccggga
caagctgagaagtacaaccaggcattgaccatcatcgccaaagacaaaaatagctctcta
cttagcagcatgatttccgggcctgacgccgactctggccgtgacttgtcagaatggcct
gttggcttgcaaaacattggcaatacttgctatctcaatagcttgttgcaattctacttc
tccattcgtccattccgagagatggttttggactatgagagtttccgaatggagcttgac
gatgagagcttgagcaagaagcatgttggctctcgcaaggtcttgaagaaggaagttgag
cgctctcagacgtttttaagagaattacgaacgttgttccaagatatgattacctcttca
agatcatttgtgacgccgggtcaggagctagcacggttaaccctcatcagcccgtccaat
gaagcagctatccgtcgccggtcgaccatatctatgagcagacccggtggactcggagaa
gtcaacggtatgcctattatgggaccgcttggcccaccacagctggcgccagagccagag
cgaagtcaaaacccagttgatgccgagaaggagaagccgaaacatccaacaatcagtgat
gtggatagcgaagctactcttgtttctgacagtgtcaaattaggtacaccgttactgcct
gaggataaagaaaacgaaactccatccaaggatattgtgatgagtgaggtgcagcctgaa
cctgcgtctcagaacaatgaggacaatatctctccgaaggacgaaacaccggcaatacca
ttcgggccaccgaatcagccccccccagtgccgcctcggtcgactgtgccaatagatccc
cagaagcagctcctggaagaggtggagattggggcccaacaagatgtcacggaagtgatc
aataatgtgctctttcagagtcaatgcgcaatcaagccgatcgccttcgccccagatgga
gaacaactggaccaggtgaaagacttattctacggacggtccaagtcgtatatccttgct
gaggcgggaactcggtctaaagaggagtggtggtgcgatatcaaggtcgacgttgcaact
gggtctcgtgatatctacgcagcgattgatggggcgtttgatgcccagaaggtcaacgtt
gacaacacaatcgtcgagcaatacagtgcgattagcaagctgcccccagtgcttcagatc
caagtgcagcgagtgcaatttgatcccatcaagaagagctctttcaaatcgactcatcat
ctcgaattgaaagagaagatctaccttgaccgatacatggatacgcagcatcctgagatc
atgaatcgacgacgacagtgctgggagtggaaaaatacactgaagacgctggaggaacgc
agggccgagctgttgcgtcaaagtgaaaatgacggccttgatatggcgactttgttcgaa
agtgccaaatccgttgtcgaggaccttaactccttcaaggataatccagagacagccgaa
gaagcaatcgatattaatccgcaactctcgtctgagcttggtcaattgtctcaaatagtc
aaggctgaattgaactacgtcgaacaagagatcaagaacacacagactctgatttccagc
cagtttgtcgatttcaagcacctggcctatcgactctatgccgtattcgtgcaccatgga
tccgtcgagtttggccattactatatctatatctttgacttccggaagaacgtctggcgc
aagtacaacgataacgaagtaaccgaagtccaaaacccggatgaaattttcaagaaccaa
gaacgccagaaccccccgactccgtacttcctggtatacgtcaacgatgctctaaaagac
cgccttgtcgatcccgtctgcagacaaatcattgacaacatggcacacagtgagccagtt
tctgggacagaaccaactctcccaatggagggagtcactacgacgacacccgttccccag
gaggatctgaacatggattcccctgcctacgacgaggcattcgctgataattatacttca
ggtacgggtgctgccctccgtgtggaaaaggaccggaaaggacctgtcgacgttggcagc
aaagctcccacatcgtcatggccgtcaaacaacttggctgaccagcgtgatgtggagtgg
tag

DBGET integrated database retrieval system