KEGG   Aspergillus clavatus: ACLA_085760Help
Entry
ACLA_085760       CDS       T01148                                 

Definition
AhpC/TSA family protein
Orthology
K11187  
peroxiredoxin 5, atypical 2-Cys peroxiredoxin [EC:1.11.1.15]
Organism
act  Aspergillus clavatus
Pathway
Peroxisome
Class
Cellular Processes; Transport and catabolism; Peroxisome [PATH:act04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 181 aa AA seqDB search
MFAARRLARVPGVIPQRALFHSTAPAFVKKGDAIPDLEVLVENSPGNKVNLAKELKGKGI
ILGVPAAFSPACSSSHVPGYINHPKLKEAGQVFVVSVNDPFVTKAWGVSLDPNGKSGIRF
LGDPTGKFSEALDVTFDSTSIFGNHRGKRYALVVEDGKVKEAFIEPDNTGVDVSAAEKVL
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctgctcgtcgtcttgctcgtgtccctggggtcattccccagagagcgctcttc
cacagcactgcgcccgccttcgtgaagaagggcgatgccatccccgacctcgaagtcctg
gtcgagaactcgcctggtaacaaggtgaacctcgccaaagaactcaaggggaagggaatc
attctcggtgtccctgctgcttttagcccggcttgctccagctcccatgtccccggatac
atcaaccaccccaagctcaaggaagcgggccaagtctttgtggtctccgtcaatgacccc
ttcgtgaccaaggcgtggggcgtctctctggaccccaacggcaagagcggcattcgcttc
ctgggcgacccgaccggcaagttctccgaggcgctggatgtgaccttcgacagcacttcg
atcttcggcaaccatcggggcaagcgctatgcgctagttgttgaggatggcaaggtcaag
gaggcgttcattgagccagacaacactggcgtcgatgtctcggcggccgagaaggtcttg
ggttga

DBGET integrated database retrieval system