KEGG   Aspergillus clavatus: ACLA_086050Help
Entry
ACLA_086050       CDS       T01148                                 

Definition
uroporphyrinogen-III synthase (UroS), putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
act  Aspergillus clavatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:act00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 329 aa AA seqDB search
MIPSPSYSFSSSPETPILLLKTKSSPHDGYEEFFSAQGFNPAFVPVLEHRFNQPNLHIVK
QLFESGSLSAGSDRKYGGLIFTSQRAVEGFARLISTEIDESITEQASHSLVLYSVGPATS
RSLTTLRNSHLPHATVHGADAGTGAVLAQTILEHYNALYADADADTGTDTDTARNKPPLL
FLVGETHRDIIPKTLTSVSLPPRRRIGVDELIVYGTGVMESFEGEFRAAVREGKVWLRGA
AGKHGGRAMWVVVFSPTGCDAMLRVLEAGEGVGALRGDGRRIFVATIGPTTRDHLREVYG
FEPDVCAERPSPEGVAAGIEAFMRRWKGE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgataccctccccttcatactccttctcctcctcaccggagacacccatcttgctcctc
aagaccaaatcctctccgcacgatggctacgaggaattcttctccgcccaaggcttcaac
cccgccttcgtccccgtcttggagcaccgattcaaccagccgaacctgcatatcgtgaaa
cagctctttgaatccggcagcctctcagcaggatcagaccgcaaatacggtggtctgata
ttcacgagccaaagggcggtggaagggttcgcgcggctgatcagcacggagatcgatgaa
tcaatcacagaacaagcctcccactccctcgtcctctacagcgtcggccccgcaacctcc
cgctccctcaccaccctccgcaactcgcacctcccacacgcaactgtccatggcgccgac
gccggcacaggcgctgtcctcgcgcagacaatcctcgagcactacaacgcgctctacgca
gatgcagacgcagatacaggcacagacacagacacagcccgcaacaaaccccccctcctc
ttccttgtcggcgaaacacaccgcgacatcatccccaagacgctgacgagcgtgtccctg
ccgccgcgccgccgcatcggcgtcgatgagctcattgtctacggcacgggtgtgatggag
tcgttcgagggcgaattccgggctgcggtgcgcgagggcaaggtgtggttgcgtggtgct
gcggggaagcacggggggagggcgatgtgggtggttgtgttctcgccgacggggtgtgat
gccatgctgagggtgttggaggctggtgagggggtgggggcgctgcgtggggatggacgg
cggatctttgtggcgacgattgggccgaccacgagggatcatttgcgggaggtgtatggg
tttgagccggatgtttgtgcagagaggccgagtcctgagggggtggcggcgggtattgag
gcgtttatgaggcggtggaagggggagtga

DBGET integrated database retrieval system