KEGG   Aspergillus clavatus: ACLA_086050Help
Entry
ACLA_086050       CDS       T01148                                 

Definition
(RefSeq) uroporphyrinogen-III synthase (UroS), putative
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
act  Aspergillus clavatus
Pathway
act00860  Porphyrin and chlorophyll metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACLA_086050
Enzymes [BR:act01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ACLA_086050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 4700378
NCBI-ProteinID: XP_001268334
UniProt: A1CUC1
AA seq 329 aa AA seqDB search
MIPSPSYSFSSSPETPILLLKTKSSPHDGYEEFFSAQGFNPAFVPVLEHRFNQPNLHIVK
QLFESGSLSAGSDRKYGGLIFTSQRAVEGFARLISTEIDESITEQASHSLVLYSVGPATS
RSLTTLRNSHLPHATVHGADAGTGAVLAQTILEHYNALYADADADTGTDTDTARNKPPLL
FLVGETHRDIIPKTLTSVSLPPRRRIGVDELIVYGTGVMESFEGEFRAAVREGKVWLRGA
AGKHGGRAMWVVVFSPTGCDAMLRVLEAGEGVGALRGDGRRIFVATIGPTTRDHLREVYG
FEPDVCAERPSPEGVAAGIEAFMRRWKGE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgataccctccccttcatactccttctcctcctcaccggagacacccatcttgctcctc
aagaccaaatcctctccgcacgatggctacgaggaattcttctccgcccaaggcttcaac
cccgccttcgtccccgtcttggagcaccgattcaaccagccgaacctgcatatcgtgaaa
cagctctttgaatccggcagcctctcagcaggatcagaccgcaaatacggtggtctgata
ttcacgagccaaagggcggtggaagggttcgcgcggctgatcagcacggagatcgatgaa
tcaatcacagaacaagcctcccactccctcgtcctctacagcgtcggccccgcaacctcc
cgctccctcaccaccctccgcaactcgcacctcccacacgcaactgtccatggcgccgac
gccggcacaggcgctgtcctcgcgcagacaatcctcgagcactacaacgcgctctacgca
gatgcagacgcagatacaggcacagacacagacacagcccgcaacaaaccccccctcctc
ttccttgtcggcgaaacacaccgcgacatcatccccaagacgctgacgagcgtgtccctg
ccgccgcgccgccgcatcggcgtcgatgagctcattgtctacggcacgggtgtgatggag
tcgttcgagggcgaattccgggctgcggtgcgcgagggcaaggtgtggttgcgtggtgct
gcggggaagcacggggggagggcgatgtgggtggttgtgttctcgccgacggggtgtgat
gccatgctgagggtgttggaggctggtgagggggtgggggcgctgcgtggggatggacgg
cggatctttgtggcgacgattgggccgaccacgagggatcatttgcgggaggtgtatggg
tttgagccggatgtttgtgcagagaggccgagtcctgagggggtggcggcgggtattgag
gcgtttatgaggcggtggaagggggagtga

DBGET integrated database retrieval system