KEGG   Aspergillus clavatus: ACLA_088540Help
Entry
ACLA_088540       CDS       T01148                                 

Definition
eukaryotic translation initiation factor 3 subunit EifCj, putative
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
act  Aspergillus clavatus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ACLA_088540
Translation factors [BR:act03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    ACLA_088540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 268 aa AA seqDB search
MTPSKWDDEEESVSPPPVVNRRKFDDEEDEEVLDSWDAAEDSEVEREKAAKAAEAKAKAE
AEAAAKKKSKAQRIEEHKAERRKNAEADSEEDEDEDEDEAEKRARLRRTEKDSDLKHAED
LFGDIDLNRSRNRGAPKAIVISDSADPTQAVDLSAMPLFKPTTKDQFARLTTTLIPLLTA
HSKKPHYALWAQEFTKQLVKELNSGDVKKIASALTTVSNEKMREERAADKGSKKSKAAKT
KVSLVANRDNKIDATSYDDDGLEDDDFM
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacaccttcgaagtgggacgatgaggaggagagcgtttcccctccccctgtggtgaac
cgccgcaagttcgacgacgaggaggatgaagaggtgctcgactcgtgggacgcggccgaa
gactcggaagtagagcgcgagaaggcggccaaggcggcagaggccaaggccaaagcggag
gccgaagcggccgcgaagaagaagagcaaggcgcagcggatagaggagcacaaggcggag
cggcggaagaacgcggaggcggacagcgaggaggatgaggacgaggacgaggacgaggcg
gagaagcgggcgcggctgcgccgcacggagaaggactcggacctcaagcacgccgaggac
ctgttcggcgacatcgacctgaaccgcagccgcaaccgcggcgcccccaaggccatcgtc
atcagcgactcggccgaccccacgcaggccgtcgacctgtccgccatgccgctgttcaag
cccacgaccaaggaccagttcgcgcgcctgaccaccaccctcatcccgctgctgacggcg
cactccaagaagccgcactatgcgctgtgggcgcaggagttcaccaagcagctcgtcaag
gagctgaacagcggtgatgtcaagaagatcgccagtgcgctgaccaccgtcagcaacgag
aagatgcgcgaggagcgcgccgccgacaagggcagcaagaagagcaaggcggccaagacc
aaggtctcgctcgtcgcgaacagagacaacaagatcgatgctacctcttatgacgatgat
ggactggaggatgatgactttatgtga

DBGET integrated database retrieval system