KEGG   Aspergillus clavatus: ACLA_089110Help
Entry
ACLA_089110       CDS       T01148                                 

Definition
ubiquitin C-terminal hydrolase L3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
act  Aspergillus clavatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 273 aa AA seqDB search
MTDHVDVPDTKKAFVPLGTHPSQKHQVELLSILTSPPPSPENNPEVMSHLVHQLGLPPTL
GFIDVYSIDEPDLLAFVPRPSHALLLVFPVSPTYEASRIAEDKPLPEYTGSGPTEPVMWF
KQTIRNACGLIGLLHAVANGEPRKHITPGSDLDSLLREAEPLAPVARADLLYESKALESA
HADAARLGDTAAPQAEDNVDLHFVAFVKGADGRLWELDGRRKGPLERGVLAADEDALSEK
ALDLGVRRFLKTEAAGGNPDLRFSLVSLGPSFE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccatgtggatgtccccgacacaaagaaggccttcgtgcccctcggtacacac
ccctcccaaaagcatcaagtcgaattactcagtatactaacatcccctcccccttcccca
gaaaacaacccagaagtcatgtcccacctcgttcaccaactaggtctaccccccaccctc
ggcttcatcgacgtctactccatcgacgaaccagatctcctcgccttcgtcccgcgaccc
tcccacgccctcctcctcgtcttccccgtctcccccacctacgaagcctcccgcatcgcc
gaagataaacccctacccgaatacacaggctccggacccacagagcccgtcatgtggttc
aagcagacgatccgcaacgcctgcgggctcatcggcctcctgcacgccgtcgccaacggc
gagccgcgcaagcacatcaccccaggctcggacctagactcgctgctgcgggaggcggag
ccgctggcgcccgtcgcgagagcggatctgctgtatgagagcaaggcgttggagagcgcg
catgcggatgcggcgcggctgggggacacggcggcgccgcaggcggaggataatgtcgac
ctacactttgtggcgtttgtgaagggggcggatgggcggttgtgggagctagatgggcgg
aggaaggggcccttggagaggggggtgttggcggcggatgaggatgcgttgagtgagaag
gcgttggatttgggggttaggaggttcttgaagacggaggctgccggagggaatccggat
ttgaggtttagtttggtcagtctggggccttcgtttgagtag

DBGET integrated database retrieval system