KEGG   Aspergillus clavatus: ACLA_089470Help
Entry
ACLA_089470       CDS       T01148                                 

Definition
Glycosyl hydrolase, family 15, putative
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
act  Aspergillus clavatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:act00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 494 aa AA seqDB search
MLTNSLVLAGTLAGTAWASPAHFSFKRQSDIGDFIKSETTFAKQGLLNNIGADGTLVKGA
AAGVVVASPSKQNPDYFYTWTRDSALTLLEVIEQFIAGDDSLEALIHSYIDAQAKLQTVS
NPSGQLSDGSGLAEPKFNVDLSAFTGAWGRPQRDGPALRASALIAYGNALIAKGKDSVAK
QHLWPIVANDLAYVGQYWNQTGFDLWEEVQGSSFFTTAVQHKSLIEGAAFAKALGETCAG
CAVAPQILCFLQDYWNGKNIVSNIANNGRSGIDSNSVLTSIHTFDPEAACDDTTFQPCSA
RALSNLKVYVDAFRSIYGVNKDRPVGKAAATGRYPEDNYQGGNPWYLTTLAVAEQLYDAL
YQWDKQGAIEVNELSLPFFKDLSSNVTAGSYAKGSGGYTSLTGAVKTYADEFIAVIKEYT
PEKGNLAEQFGRDSGKPVSASDLTWSYASFLTAASRRAGQVPASWGASGANKVPGSCSGQ
TVTGSYAAPSAVAW
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccaattcgctcgttcttgccggtacccttgcgggcaccgcttgggcctctcct
gcccatttttcattcaagagacaatccgacatcggcgacttcatcaagagcgagaccacc
ttcgcgaagcagggattgttgaacaacattggagctgatggcacactcgtcaagggcgct
gctgccggtgtggtcgtggcatctccctccaagcagaatcccgactacttctacacctgg
actcgtgactctgctctgaccctgctcgaggttattgagcagttcattgctggcgacgac
tcgctcgaagccctcattcacagctatatcgatgcccaggcaaagctgcagaccgtctct
aacccatccggacagctgtctgacggatctggactggccgagcccaagttcaacgtcgac
ctctcagccttcactggtgcctggggccgtcctcagcgtgatggacccgccctgcgcgct
tctgctctgatcgcctacggaaatgctctgatcgccaagggtaaggattccgttgccaag
cagcacctctggcccattgtcgccaacgatctggcctatgtgggtcagtactggaaccag
accggcttcgatctgtgggaagaagttcagggttcgtccttcttcaccactgctgtccag
cacaagtccctaatcgagggtgctgccttcgccaaggcgctgggtgagacttgtgctggc
tgtgccgtggcacctcagatcctatgcttcctccaggactactggaatggcaagaacatt
gtctccaacattgccaacaacggccgcagcggaatcgactcgaactctgtgcttacttcc
attcacaccttcgatcctgaggctgcctgtgatgacaccactttccagccttgctctgcg
cgggctttgtccaacctcaaggtctatgttgacgctttccgctctatctatggtgtcaac
aaggatcgccctgtcggcaaggccgccgccaccggccgctatccggaggataactaccag
ggaggaaacccatggtacctcaccaccctcgccgtcgccgagcagctctatgacgccctc
taccagtgggacaagcagggagccattgaggtcaacgagctctcgctccccttcttcaag
gacttgagctccaacgtcactgctggttcgtacgccaagggctccggtggctacacctcc
cttactggtgctgtgaagacctacgcggacgaattcatcgccgtcatcaaggagtacact
cctgagaagggcaacctcgctgagcagttcggccgggactctggcaagcctgtctccgct
tccgatctgacctggtcctatgcttcgttcctgacggctgcctccagacgcgccggccag
gtccctgcctcttggggcgcgtccggtgcgaacaaggtgcctggctcgtgcagcggtcag
accgtcaccggttcctacgccgctccctccgctgttgcgtggtag

DBGET integrated database retrieval system