KEGG   Aspergillus clavatus: ACLA_089940Help
Entry
ACLA_089940       CDS       T01148                                 

Definition
ubiquitin C-terminal hydrolase, putative
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
act  Aspergillus clavatus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:act00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ACLA_089940
Enzymes [BR:act01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ACLA_089940
Peptidases [BR:act01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ACLA_089940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1111 aa AA seqDB search
MTLDTAALPSPPDFAPWKNPNRPKSLGGMQPGTEQIGRSDARQNGNNGPSGPPRFPNIKD
LQDQAAALDLNESTPLDILVGRAQEAIGLARNYADNEELDKAYVQYLRASEITINIIPHH
PDYRVTVNQSPAWYKQFANLMMAVRTKQGTMDDIKQLILEDNLASNTQPMATSRHGNSGR
LESASGTHQGASSRGRQNEMSDSSLRMPSPSEFQRVPALQANPNRYSAPADDLLAQRFAK
LRASPYPANGQGPFSNGENGAVHTPSPPGYLGDYPPRPLSYIHQGTRSNSTLSSPSRRPL
GPRNMGATHNVPNLPPKILLNTSLPRAPDPAYSPIWTVPTQPPSNPPRTSTESSRPANPR
YSQLINSPHGSPSRGSEDNPYRSTTPNGIHAIREVKSNSADLPHSTTISAQALLEYIRKY
NIMLIDVRPRDQFDSGHIYAKSILCIEPVSLKENVSAEELEERLVVSPEHEQSLFERRNE
FDLIVYYDQSTDSVSYLAGSPVGTTAPHLRALHDTLYEFNAYKPLKDGRPPALLLGGLDA
WIDLLGQQSLATSSTAAVMGSIQAKRPAMRPGRPLGRVPTMASANSSLEVRKRRLREYKP
LNPEELTAWMEKSKNEEIDTSTYVDEGTLTEEPEDASEQQESPVTPFVHTYEDFLRRFPE
PHAIQESMVGPHSHPTAPSSTPNYAAPVPVVPSRPPPAVPRPSYSGVSDGRLIQAPLERQ
SSATKTALYTSNSLLSRLKLPRTGLTNFGVTCYMNSTIQCLSATIMLSKFFIDNRFRYYV
QKNWKGSQGVMPGLFANLIRSLWKNDVEVIMPTSFRNFCGRLNQEWAIDRQQDAKEFFDF
VVDCLHEDLNINWQRTPLRPLTFEEEMQRERMPVPKVSRIEWDRYCHREESFISSLFAGQ
HASRLRCTTCKRTSTTYEAFYSISVEIPSTGTGDIYQCLRSYCQEEMLSGDEVWKCPYCK
CEREATKQIIITRAPQILVVHFKRFSASKTQSARKIHTPIDFPLHGLRMDDFVIYPNLGA
SSDGRVAGAPQEMISATMPPFTYDAYGVLRHIGSSMGSGHYISLVRDAQRQCWRKFDDDR
ATDFNPRDMRFKDRLQNEQAYIVFYERVPAK
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atgactttggacacagcggctttaccctcgccgccagattttgcgccgtggaagaatccc
aaccggcccaagtccttgggtggcatgcaaccaggtactgagcaaatcggcagatcggat
gcacgccagaatggcaacaatggcccttctggaccaccacgattccccaacatcaaagat
ttacaggatcaagcggcagccttagatttgaatgaatctactccgttggatatactagtg
ggaagagcgcaggaagcaattggactcgcaaggaattatgccgataatgaagagctggat
aaggcatatgtgcaatatctacgtgcttcggagatcacgatcaacattatacctcaccat
cccgactaccgcgtcaccgtcaatcagagcccagcatggtacaaacaattcgccaatctc
atgatggccgtgcggacgaagcaagggacgatggacgatatcaaacaactaatcttggag
gataacctggccagcaacacacaacctatggctacatctcgccacggtaattcggggcgg
ctagagtcggcttctgggacgcatcagggcgcgagttctcgaggccgtcaaaatgagatg
agtgacagctcgctacgaatgccgagcccttcggaatttcaaagagttcctgctttgcaa
gcgaacccgaaccgatactcagcccctgcggacgacttgcttgctcagcgattcgctaaa
ctaagagcatcaccatatcccgccaacggtcaaggcccgttcagcaatggggaaaacggc
gcggttcacacgccctcgccgcctggttacttgggcgattaccctcctcgaccattgtct
tacatacatcagggaacgcgatcaaattcaaccctaagctctccctctcgacgtcctttg
gggccccgaaatatgggcgccactcacaatgtgcccaatctgccccccaagatccttctc
aatacctctctacctcgcgcgcctgacccagcctacagtccaatatggaccgtgcctact
cagcccccatcaaatccgcccagaacatctaccgaaagttcgcgcccagctaatccccga
tattcacagctgatcaactcgccacacggcagtcccagtcgtggctcagaagacaatccc
taccgctcaacaacaccgaatggcatacatgcaattcgagaagtcaaaagtaacagtgcg
gacttaccgcattccactaccatctctgctcaagctttgcttgagtacattcgaaaatat
aatatcatgctgatcgatgtcagaccacgagatcaatttgacagtggccacatctacgcc
aaatcgatactctgcatcgaacccgtgtcattgaaagagaatgtatcagcagaggaactg
gaagagcgtctcgtggtatctcccgagcatgaacaatcactgttcgaaagacgtaacgag
tttgacctcattgtctactatgaccagagtacggactcggttagctaccttgctgggtcg
cctgttgggacaaccgctccccatcttcgggccttgcacgataccttatatgaattcaat
gcgtataagccgctgaaggatggacggcctccagcattgctcctaggtggtcttgatgca
tggatcgatcttctgggtcagcagtctctggccacatcttccacagccgcggtgatgggt
tcgattcaggcgaagaggcccgcgatgagaccaggacgaccgcttggaagagtaccgacc
atggcaagtgccaattccagcctcgaggttcggaagagacgactacgagagtataagcct
ctgaatccggaggagctgacggcatggatggagaagtccaagaacgaagagattgatact
agcacctatgtcgatgaggggacgctgaccgaagagccagaagacgcttctgaacagcaa
gagtccccggtgacaccgtttgtgcatacctacgaagatttcctgcgacggttcccagaa
ccccatgccattcaggaatcgatggtaggaccgcattcgcacccaacggcaccctcatca
acacccaattacgccgcccctgtgcccgtggtgccgtcgcggcctcccccagctgtaccc
cgtcctagctacagtggtgtgtctgatggtcggctgatccaggccccgttagagcggcag
agctccgcgaccaagacagctctgtacacctccaattctttgttgagccgcctgaagctc
ccgcgaacggggctgaccaattttggggtaacttgctacatgaactcgacgattcaatgc
ctcagcgcaacgatcatgctgagcaagttcttcatcgacaatcgcttccggtactacgtc
caaaaaaactggaaaggatcacaaggggtcatgcccggactgtttgccaatttgatcagg
tcgttgtggaagaatgatgtggaggtgatcatgcccacgtcgttccgcaatttctgcggc
cggctgaatcaggagtgggccattgatcgccaacaggacgccaaggaattctttgacttt
gtggtggactgtctgcatgaagacctcaacatcaattggcagagaacacctcttcggccg
ttgacattcgaggaggagatgcagcgggagcgcatgcccgtgcccaaggtctccaggatt
gagtgggaccgctactgccaccgcgaggagtccttcatctcctcgctctttgctgggcag
catgccagccgactgcggtgtacaacctgcaagcgaacttccacgacgtacgaagcattt
tacagcattagcgtggagatcccctccactggcacgggcgatatttaccaatgccttcgc
agctactgccaagaggagatgctcagcggggatgaagtgtggaagtgcccttactgtaaa
tgtgaacgggaagcgacaaagcagattatcatcactcgagcgcctcaaattttggttgtc
cacttcaaaagattctctgcctctaagacgcagagcgcgcgcaaaatccacacgcccatt
gactttccgttacacgggcttcggatggatgattttgtgatctaccccaatttgggggcg
tcctctgacggccgggttgcgggggcgccacaggagatgatctccgcgacgatgccgccc
ttcacgtacgatgcgtatggggtcttgcgccacatcggctcctccatgggcagcggacac
tacatctcattggtgcgggatgcgcaacgccagtgctggcggaagtttgacgatgatcgg
gcgacggactttaatcctcgtgacatgcgcttcaaggaccggctgcagaatgaacaggca
tacatcgtattctacgagcgggttcctgccaagtaa

DBGET integrated database retrieval system