KEGG   Aspergillus clavatus: ACLA_090710Help
Entry
ACLA_090710       CDS       T01148                                 

Definition
histone deacetylase HosA
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ACLA_090710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 487 aa AA seqDB search
MARSAIVQEYNPPPTTTPTLSLDQKVSLERQTNGIPRPQGYRVSWHANPAVEPHHFGQSH
PMKPWRLTLTKQLVMAYGMHHAMDLYLARAATYEELADFHTTDYLDFLQQVMPGDMENPA
QSENVARFNFGDDCPIFNGLYNYCSLYAGGSIDAARKLCNNQSEIAVNWSGGLHHAKKAE
ASGFCYVNDIVLGVLQLLRHHPRVMYIDIDVHHGDGVEQAFWSTDRVLTVSFHKYDRDNF
FPGTGPLDSNGPTHPLNPGAHHAINVPLNDGIDDESYIQLFRDVIGPCINTYHPGAIVLQ
CGADSLGCDRLGCFNLNVGAHGACVAFVKTFGLPMLVVGGGGYTPRNVSRAWAHETSILI
DAQDLIDPNIPDTVAFRNHFGPDYSLFPPLSEMRKLENKNTRQYLASLVQTVHEQLRYIK
GAPSVQMSFIPPDILGLREDTEKEIEEATAMLEEEREERDGAGGTVAKAGRRRELEKGLG
TRGELYA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgctccgccattgtccaggagtataatccgcctcccacaacaacgcccactctc
agtctcgaccagaaggtttcccttgagcgacagacaaatggtattcctcgtccgcaaggc
taccgggtctcctggcacgccaacccggccgtggagccacaccactttggccagtcgcat
ccgatgaagccctggcggctgacgctcacgaaacaactcgtcatggcgtacgggatgcat
cacgcgatggacctctacttggcccgggcggcgacatacgaggagctggctgatttccac
acaacagactacctggatttcctgcagcaggtaatgccgggagacatggagaacccggcg
cagagcgagaatgtcgcacggttcaactttggcgacgactgccccatcttcaacgggctg
tacaactactgctcgctgtacgcgggcggcagcatcgacgcggcacgcaaattgtgcaac
aaccagtccgaaatcgcggtgaactggtccgggggcctgcaccacgccaaaaaggccgag
gcgagcggcttctgctacgtcaacgacatcgtcctcggcgtcctgcagctgctgcggcac
cacccgcgcgtcatgtacatcgacattgacgtgcaccacggtgatggcgtcgagcaggcc
ttctggtcgaccgatcgcgtcctcaccgtctccttccacaaatacgaccgcgacaacttc
ttccccggcacgggccctctggacagcaacggccccacccacccgctcaatccgggcgcc
caccacgctatcaacgtccccctcaacgacggcattgacgacgagtcctacatccagctc
tttcgcgacgtcatcggcccctgcatcaacacctaccatcccggcgccatcgtcctgcag
tgcggtgccgactcgctcggctgcgaccgcctcggctgcttcaacctcaacgtcggcgcc
cacggcgcctgcgtcgccttcgtcaagacctttggcctcccgatgctcgtcgtcggcggc
ggcggctacaccccgcgcaacgtgtcccgcgcctgggcccacgagacctccatcctcatc
gacgcccaggacctcatcgaccccaacatccctgacaccgtcgccttccgcaaccacttc
ggcccagactactccctcttcccgcccctgtccgagatgcgcaagctcgaaaacaagaat
acccgccagtacctcgccagcctcgtccaaaccgtccacgagcagctccgctacatcaag
ggcgcccccagcgtgcagatgagcttcatccccccggacattctgggcctgcgcgaggac
acggagaaggagattgaggaggccaccgccatgcttgaagaggagcgcgaggagcgggac
ggcgccggcggcacagtggccaaggccggtcgacggcgggagctcgagaagggtctgggg
acccgtggggaactgtatgcatga

DBGET integrated database retrieval system