KEGG   Aspergillus clavatus: ACLA_091130Help
Entry
ACLA_091130       CDS       T01148                                 

Definition
histone deacetylase RpdA
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ACLA_091130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 689 aa AA seqDB search
MTALPPVDLDLSSASKDRGKKVAYFYDSDVGNYAYVSGHPMKPHRIRMTHSLVMNYGLYK
KMEIYRAKPASRYEMTQFHTDEYIDFLSKVTPDNMDQFAKEQGRYNVGDDCPVFDGLFEF
CGISAGGSMEGAARLNRNKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRFKQR
VLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGQGKNYAVNFPLR
DGIDDVSYKSIFEPVISSVMEWYRPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNFVK
SFNLPTMIVGGGGYTMRNVARTWAFETGVLLGEVLGPELPYNDYYEYFAPDYELNVRPSN
MDNANTKDYLDKIRAQVVENLKRTAFAPSVQMTDVPREPLLEGMDDEADAILDDLDEDEN
KDKRFTKRRFDQYIEKPGELSDSEDEEENAANGIHPKAAGLKRRNQANYRNADLDSGPNS
GIATPQEASSIPDDEMDTTIDAKMGEALPPATDIAPTPSAAEPAPSADEKAVVESTEMAI
DEPEETAASAVASRQPSPKMHDEDTTMEDAGEPVPEPEQSKQPEPSVETQEEEAKPETSA
PETTATEPSPSAKISPASKETDASEKPETKVATDSSEVKTKETTPEISSDQQVVKPDQEA
PKESEEAKQVTEKEPTSTQQPEEPAKSLE
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgactgccctacctcctgttgatctggatctttccagtgcctccaaggatcgcggtaag
aaggtcgcatacttctacgactcggacgttggaaactatgcctacgtatcgggacatcct
atgaagccacaccgtatcaggatgacacacagcttggtcatgaactatggcttatacaag
aagatggaaatctaccgtgcgaaaccggcgtccagatatgagatgacacaatttcacacc
gacgaatatatcgacttcctttcgaaggtgacaccagacaatatggatcaattcgcaaaa
gagcagggtagatacaacgtcggtgatgattgtccagtctttgatggattgtttgagttc
tgcgggatcagcgcgggaggcagcatggaaggcgcggcgcggcttaatcgcaacaagtgc
gacatcgctgtcaactgggctggaggtcttcaccatgcaaagaagagtgaagcgagtggt
ttctgctacgtaaatgacattgtccttggtatcctcgagctgctacgattcaagcaacgt
gttctctacgtcgacattgatgttcaccacggagatggtgtcgaagaagctttctacacc
accgaccgtgtcatgaccgtttccttccataagtatggagagtatttcccgggtaccggc
gagcttcgtgacattggagtgggacaaggcaagaattatgcggtcaactttccccttcgc
gacggcatcgatgacgtttcctacaaaagcatttttgagcctgtcatcagcagtgtcatg
gaatggtaccgccctgaagccgttgtccttcaatgcggtggcgacagtctctcgggtgat
cgccttggctgtttcaatctcagtatgcgaggccacgcaaactgcgttaatttcgtgaaa
agcttcaacctgccgaccatgattgtcggtggtggtggttataccatgcgcaatgttgcg
cgaacgtgggcttttgagactggcgtccttctcggggaggttctaggtccagagctgcct
tacaatgattactatgagtacttcgcccccgactacgagctgaatgtccgcccgtcgaat
atggacaatgccaataccaaggactatcttgacaagattcgggctcaggtggtcgagaat
ctcaagcgtacggctttcgcgccgtccgtgcagatgactgatgtacctcgtgagccgctc
ctcgaaggtatggacgacgaggcagacgcgattcttgatgatttggatgaggatgaaaac
aaagataaacggttcacgaagcgacgattcgaccaatacatcgagaagcccggtgaactg
agtgatagtgaagatgaagaggagaatgcggccaacggaatccatcctaaagctgcaggg
ctgaagcggaggaatcaagccaactaccggaacgccgatctggattctggacccaacagc
ggaattgcgaccccgcaagaagcttcttcgattccagatgacgagatggatactaccatc
gatgcaaagatgggtgaagcgcttccaccagctactgatatcgcgcccaccccctccgct
gctgaacctgctcccagcgcagatgaaaaggccgttgtagagtcaactgaaatggccatt
gatgaaccagaagagactgcggcttctgctgtcgcttctcgtcagccatctcccaagatg
cacgatgaagataccaccatggaagatgcgggcgagcctgtccccgaaccggagcaatct
aagcagcctgagccatcagtcgagacacaggaagaggaggcaaagcctgaaacatcggca
ccagaaacgacagctacggagccttctccctcagcaaagatttctcccgcttcaaaagag
acagacgcctcagagaagccagagaccaaggtagctaccgattcatcagaggtcaagacg
aaggaaacgactcccgagatttccagtgatcaacaggtcgtcaagcccgaccaggaagcc
cccaaggagtcagaggaggctaagcaagttactgaaaaagagccaacctcaacacaacaa
cctgaggagcctgcaaagagcctggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system