KEGG   Aspergillus clavatus: ACLA_091300Help
Entry
ACLA_091300       CDS       T01148                                 

Definition
(RefSeq) alpha-amylase AmyA
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
act  Aspergillus clavatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACLA_091300
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ACLA_091300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 438 aa AA seqDB search
MISPISQNVEGRVPYGEAYHGYWIQDMYALNSHFGTHQDLLDLSKALHDRGMYLMVDTVI
NNMAYITDGGNPATSIDYTVLSPFNDPKFFHPYCKITDYNDYPMAQRCWTGDDIIPLPDL
KTEDSKVQSMLEDWIKQTMSTYSIDGLRLDAAKHITPTFLPSFQNASGAFITGEVFEPSV
KTICEYQNDLPSVPNYPIYYSILEAFTKANTSSLTNQVEVMKQTCPNLAKNVLTFTILFD
GIPMIYQGQEQHFSGASDPENREALWLSSYDTNAPLYQLVGKLNRIRKHAAQIDPAYLET
QTYPIYTGRSEMGFRKGQEGRQLVMVLSTQGANSSKYELDMPIGYQPGFVVMDVLSCVSY
LVNDMGLLKIDMDKGEPRVLFPVNMMEGSGLCGFQISNEPTYLTLKKRPMRSSGSKVVAW
SILTLSSIIIGFVTTCTV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatttctccaatctcccagaatgtggaaggacgtgtaccctacggagaagcctatcat
ggatactggattcaagacatgtatgcgttgaattcacacttcggcacgcatcaagatctg
cttgacttgagtaaagctctccatgatcgaggcatgtacttgatggtagatactgttatc
aacaacatggcatacatcaccgacggtggaaacccggcaactagcattgattatacagtt
ctcagtcctttcaacgatccgaagttcttccatccatattgcaagattaccgactataat
gactatcccatggcgcaacggtgctggacgggcgacgacattattcctcttccagacttg
aagacagaagatagcaaagtgcagagcatgcttgaagactggatcaaacagaccatgtct
acatatagcattgacgggttgcgtctggatgcagcaaagcatattacccctaccttcttg
ccatcgttccaaaatgcatctggcgcctttattaccggcgaggtcttcgaaccctcagtg
aagacaatctgcgaataccagaatgaccttcccagtgttccgaattatcctatctactac
tcaattcttgaggcattcaccaaggccaatacgagttcgttgacgaatcaagtcgaggtt
atgaaacagacttgtcctaaccttgccaagaacgtcctcacattcacgatcctctttgac
ggtatcccgatgatctaccagggccaagaacagcatttctcaggtgcaagtgaccccgag
aatcgcgaagccttatggttatcgagttatgacacgaatgcccctctctaccagcttgtt
ggaaaattgaacaggatccgcaagcacgcagcccagatcgatccagcatacctggagaca
caaacctaccctatctacacaggccgaagtgagatgggtttccgcaaaggccaggagggc
cgtcaacttgtgatggtcttatcgacccagggcgcgaacagtagcaaatacgagctggac
atgccaattggctaccagccggggtttgtggttatggatgtgcttagctgtgtcagttac
ttggtcaatgatatgggacttctcaagatagacatggacaaaggagaacctcgggtctta
tttcccgtcaatatgatggaaggcagtggtctgtgtgggtttcagatatcgaacgagccg
acataccttacgctgaaaaagagaccaatgcggtcctctgggagcaaggtcgtcgcttgg
tccatcctgaccttgtcatcaataatcataggctttgtcacaacttgtacagtatga

DBGET integrated database retrieval system