KEGG   Aspergillus clavatus: ACLA_091730Help
Entry
ACLA_091730       CDS       T01148                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
act  Aspergillus clavatus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACLA_091730
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ACLA_091730
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACLA_091730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 610 aa AA seqDB search
MARDEPLLAQRPSSENSSIRNAEEEDALLTGERTNRSRQDRHPWAFWREVGLFTWALLAT
TAVIVLAVVYQHDTGRTNPDSKPSWGPGGKPTGKRNLIFMVSDGMGPTSLSMTRGYRQFT
EGLPIDDILVLDGHLVGTSRTRSSSSLVTDSAAGATAFSCGFKSYNGAISVLPDHSPCGT
VLEAASLAGYKTGLVVTTRITDATPACFASHVNRRQYEDRIAEQEIGEHPLGRVVDLILG
GGRCHFLPNSTDGSCRADDRDLVSIAKEKGFSYLDDRKGFDSLNGGSEAKLPLLGLFAEK
DIPFEIDRRTQNDVYPSLEEMARTALKILSDATADSEQGFFLLIEGSRIDHAGHGNDPAA
QVHEVLAYDKAFAAVLEFLEQDSTPGVVVSTSDHETGGLAAARQLHYTYPEYRWLPGVLA
NASHSTEYVDGKLQEYLATKTSKSSQRSYARELLEKGLGITDATDEEVDALIDDDYPVAS
QYVFADIISRRAQIGWSTHGHSGVDVNIYASSTKDAWPLVGNHENTQVGNFLADYLDLDV
DSITKRLQSSGSWAPADAHPASSAARPFTWLGDPLSEDVRTEGLDTYHGDFRKRGLDVDG
EEGCDCGGVH
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgacgagcctcttctggctcagcgtccttcttcggagaactcgtcgattcgg
aatgccgaagaggaggacgccctgctcaccggagaacgcaccaaccgcagccgccaggac
cgtcatccatgggccttttggcgagaggtcggtctcttcacctgggcgctcctagccaca
actgccgttatcgttctcgcggtcgtctaccagcatgacaccggccgaaccaaccccgat
tccaagccctcctggggacccggaggcaagccgaccggcaaacgcaacctcatcttcatg
gtctccgacggaatgggcccgacaagtctctctatgacgagaggttatagacaattcacg
gaggggctgcccatcgacgacatcttggtgctggacggccatctggtcggaacgtcgagg
acgagatcgagttccagcctcgtgacggattccgcagccggtgcgactgccttctcgtgc
ggcttcaagagttacaacggtgcgatctctgtgctacccgaccactccccctgtggcacc
gtgctcgaggctgcttctctggccggctacaagaccggtctcgtggtgacgactcgtatc
accgatgccacgcccgcctgtttcgcttcgcacgtcaaccggcgccagtatgaggaccgt
attgcggagcaggagatcggtgagcacccgctagggcgcgtggttgatcttatcctcggt
ggtggccgctgccatttcctgcccaactccaccgacggcagctgccgagcagacgatcgg
gatctggtcagtatcgcgaaggagaaggggttcagttatctcgatgaccggaagggcttt
gactcgctgaacggtggatcggaggccaagctgccgctgctgggtctgttcgcagagaag
gacatcccgttcgagatcgaccgtcgcacgcagaatgacgtctacccttccctggaagag
atggctcgcactgcgctcaagattctcagcgatgctactgctgatagcgagcaagggttc
ttcttgctgattgaaggctcccgtatcgatcatgcggggcatggaaacgaccctgcggcc
caggtgcacgaggtccttgcctacgataaggcgtttgccgctgtgttggagttcctcgaa
caagactcgactcccggcgtggtggtcagcacttctgaccacgaaactggtgggttggcg
gcagcacgccagctgcactatacgtatccggagtacagatggcttcctggcgtcctcgcc
aatgccagccactctaccgaatacgtcgacggcaagctccaggaatacctggctaccaag
accagcaagagcagccagcgatcctatgcccgggagctgctggaaaagggcctggggatt
acagacgcaaccgacgaggaagttgatgctctcattgacgatgactatccagtagcctcc
cagtatgtattcgcagatatcatcagccgacgagcacagatcggctggtcgacccacggc
cattctggcgtggacgtcaacatctatgcctcttcaacgaaagatgcctggcctctggtg
ggcaaccacgagaacacccaagtcggcaactttctggcagactacctcgacctcgatgtg
gatagcatcaccaagcgcctgcagtcatccggctcctgggccccagcggacgcgcatccc
gcctcctccgccgcccgacccttcacctggctgggcgacccgctgagcgaagacgtccgc
accgagggcctggacacctaccacggcgatttccggaaacgcggtctggacgtggacggc
gaggagggatgcgactgtggaggagtgcactga

DBGET integrated database retrieval system