KEGG   Aspergillus clavatus: ACLA_092290Help
Entry
ACLA_092290       CDS       T01148                                 

Definition
meiotic regulator-interacting protein, putative
Orthology
K07204  
regulatory associated protein of mTOR
Organism
act  Aspergillus clavatus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1461 aa AA seqDB search
MRDPNLNMEQDTAAKPQASSLQAEPRKNHKSVRVAFGPDLETYIPPRDKSPVPSLGHHRS
FTTVDHIQPLPPSTHIARPTSSSAGDHSAILDSNTRPQLDRVSDYVRPTAALKRAKSDYG
PRLGFDRAATGDDEEDFAMRHGWQEEYTSSEYLKILHSNFYMYFTEKRHETNGVPRDPVG
SWPSQDWRMKDRLKTVSAALAICLNIGVDPPDVVKTNPAAKLECWVDPTSTTGGGQNKIM
EQIGKKLQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPT
QSGEIWVFNKNYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGNIVQNFHTFVEKHEKENVE
ARKRDPNAIVQNYGDCILLAACQKNESLPTNPDLPADLFTCCLTTPIEIALRYFILQNPL
QTNLSIDEFRVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALF
RNFLLSERIMRTYKCHPISSPELPETHHHPLWKSWDLAVEMVLSQLPALIDHEEGRRQYE
YQHSSFFAEQLTAFEVYLSSGPTEKNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPW
AVHLALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISIL
NPSSPIPVGNASEHRAMCAFIVSIFCKNYPQGQNVCLSGELFDSCLKHLTDVENPLLRQW
SCLCISMLWSDFPEAKWMGIRCAAPARLCELNFDPVPEVRAAMLHAATTFLGIPDLTDQV
AQIEESLALAVLPMASDGNVLVRKELLVFFSTFVKRYQNKFLVAAYEEFQDEKQTLLLRL
EHDDPRGFTLEEAQNGSPNASNKAQKLSRNTTFGTIWKQILILSVDPHPDIAQDTSMVVD
FIHLTLLQSPMASLTDKIRKEIMELTSRLSQRMQIRERAESKKAAAPPPTPPSQATPPKQ
EGYLSLSIRRTASVAASLKNLAFGGPSSADQQSQSLTSPTKSRMPVTPRGRAPPEWTRPP
EVNDQVAPAGAYHQAPIPTSRGFEPRNPSGTPVIPLTSRFLDWSTEVIPGHLHLICKKYL
DVYEPFLTHLQYFREPQMKPNEPDEPGSADYNERLWRRSRNEKIITETQPLKGKAGSSRW
DNSVALLTNTSQPLKMSFHQFEDHLAVADDRDTIAIWDWQRDKRLNRFSNGNPPGSRINE
IRYINEDDQALLMTGSSDGVLKVFRNYESSQGVEVVTAFRALPELIPSTRNAGLVFDWQQ
GQGKALVAGDVKVIRVWNAATEVCTHDIPARSSSCITSLTSDQVAGNIFVAGFGDGAVRV
FDQRLKPTTSMVKVWREHKQWITNVHMQRGGLRELVSGSRNGEIRLWDLRMDDPISTVHA
SKDIVRTLSVHEHAPVFTVGTTRHEVKTFNMDGTHLSTFEPYSSFLQHNRSSPIAGTAFH
PHRTILACAALHDNHINLISC
NT seq 4386 nt NT seq  +upstreamnt  +downstreamnt
atgagggaccccaatctcaatatggagcaagataccgcagcaaagccccaggcgtccagc
cttcaggcggaaccgcgcaagaaccacaaatccgttcgtgtcgcgttcggtccagacttg
gaaacatacattcccccgcgcgacaagtcgcccgtgccctcgctaggccaccatagatct
ttcacgactgtcgaccacatacaacctcttccgccatctactcacattgctcgtccgacc
agttcgtcagctggggaccattcggccatcctagactcgaatactcgaccccagttggac
cgggtgtcggattatgtccgaccaacagcagcgttaaaaagagccaaaagtgactacggc
ccgagactaggattcgatagggctgctactggagatgatgaggaggactttgccatgcga
catggttggcaggaggagtatacctcaagcgagtatctcaagattctccattcaaatttc
tacatgtacttcaccgaaaagcgccacgaaacaaacggtgtcccgagagaccctgttgga
agctggccaagccaggattggcggatgaaagaccgactaaagacagtctccgctgccctg
gcgatctgcttgaatatcggtgtcgaccctcccgatgtggtcaagacgaacccggcggcc
aagttggaatgctgggttgaccctacgtcgactacgggtgggggccaaaacaagatcatg
gagcagattggcaagaagttgcaagagcaatatgagacgctcagcttgcgaactaggtat
aagcagtatctagacccttcagtcgatgagacgaaaaagttttgcatctcactgcgacgc
aacgccaaagatgagagagtgctgttccactacaacggccatggcgtgcctttgccgacc
cagtcgggcgaaatctgggttttcaacaagaattatacccagtacatcccggtctcacta
tacgacttgcaatcctggcttgcaggacccagtcttttcgttttcgatgtctcccatgct
gggaacattgtgcagaacttccacaccttcgttgagaaacacgaaaaagagaatgtcgaa
gcaaggaagcgagaccccaatgccattgtacagaactacggggactgcatactcttggcg
gcatgccagaagaacgagtcgctgcccactaacccggaccttccggcagatctgtttaca
tgctgcttgacaacgccaatagagatagcgctgcgctacttcatcctccaaaatccgctc
cagacgaatctctcgatcgacgaattccgagttcctggtcgtctgcaagatcgcaggagt
cctctcggggaattgaactggatcttcaccgcaatcactgacaccatcgcatggaacact
ctgccgcgcgccctattcaaaaagctattccggcaggacctcatggtcgctgccttgttc
aggaatttcctgctcagtgaacgtattatgcgcacgtacaagtgccatccgatctcttcg
ccggaacttcctgagacacatcatcatccactgtggaaaagctgggatctggccgtggag
atggtgctatctcagctgccggccctgatcgaccatgaagaaggccgcagacagtacgaa
tatcagcattcgtctttcttcgcggagcagctcactgcgtttgaggtttatctctcgtct
ggacccaccgagaagaatccaccggaccagcttcccatcgttctacaggtacttttgagt
caggcacacaggctaagagcgctcattctgctcagcaagtttcttgatctcgggccgtgg
gcggttcatttggctctaagcatcgggattttcccgtatgtcgtcaagcttttgcaatca
gcagcgcaggagctgaaacctgtcatggtgttcatatgggcacgaatcatggccgttgac
cacaccgtccagaatgatttattgaaggacaacggcatccattacttcatctccattctc
aatccttcctcgccaatcccggtaggcaatgctagcgagcaccgagcaatgtgcgcgttc
atcgtgtcgatattctgcaaaaattacccccaaggtcagaacgtctgtctctccggagag
ctctttgattcttgcttgaagcatttgactgatgtggagaatccgttgctccgccaatgg
tcatgtctatgcatcagcatgctctggtcggacttccccgaggccaagtggatgggaatc
cgttgcgctgcaccggcacgactctgtgagctcaatttcgatcccgtgccggaagtacga
gccgcaatgctccacgcagccactaccttcctcggtatcccagacttgacggatcaggtg
gcgcagatcgaggaatcattagctctggcagtcctgccaatggcgtcggacggcaatgtg
ttggtgagaaaagagctccttgtcttcttctcgaccttcgtgaagcgttatcaaaacaaa
ttcttggtggctgcctacgaagagttccaggatgaaaagcagacccttcttctccggtta
gaacacgatgacccccgtggtttcacgctggaagaagcgcagaatggatctccaaatgca
agcaacaaagctcagaaattatctcgcaataccacttttggcacgatttggaagcaaatc
cttatactttcagtggacccgcatcccgacattgcgcaggacacaagcatggtcgtcgac
ttcatccacctcactcttttacagtctcccatggcttctcttactgacaaaatccgcaag
gagattatggaacttacgagccgattatcacagagaatgcagatccgcgagagagccgag
tccaagaaggctgctgcgcctcctcccacccctccctcccaggccacccctcccaagcaa
gaaggctatttgtcattgagtattcgccggacggccagtgtggccgcttcgctcaaaaac
cttgcttttggcggcccctcctccgcagatcagcaatcgcaatccttgacatcacccacg
aagagtcggatgcctgttaccccacgaggacgagcgccccctgaatggacccggcccccg
gaagtcaatgatcaggttgcacccgctggagcttatcaccaagctccgatccctacatcc
cgcggcttcgaacctcgaaacccatccggaaccccagttataccccttacgagtcgattt
cttgattggtctacagaggtaatcccaggacatcttcatttgatatgcaagaagtatctc
gacgtctatgaaccctttcttacccatcttcagtatttccgggaaccccaaatgaagccc
aacgagccggacgaacctggtagcgcggactacaacgagcgcctttggagacggagccgc
aacgagaaaatcatcacggaaacccaacccctcaaaggaaaagccggcagcagccggtgg
gataactctgtggccctgcttacgaatactagtcagccactgaagatgagtttccatcaa
tttgaggaccacctggccgttgcggatgatcgggatactatcgccatctgggattggcag
agggacaagcgtctcaaccgattctccaatggaaatccacctggctcgcgaatcaacgag
atccgttacatcaacgaggacgatcaagctctgttgatgacaggatcctctgatggagtg
ctcaaagtcttcaggaactatgagtcctcacagggggtagaggttgtgactgcttttcgc
gctttgccggagctgatacccagcacccggaatgctgggttggtttttgattggcaacaa
ggtcaaggtaaagcgctggttgcaggtgatgtgaaggtcatccgtgtatggaacgcagct
accgaagtttgcacccatgatattcccgcgcggtcgagctcgtgtatcacgtccttgacg
tctgatcaggtagccggtaacatttttgtggcgggattcggtgacggtgccgttcgcgtg
ttcgaccaacgtctgaagcccacgacgtcgatggtcaaagtgtggcgtgagcacaaacaa
tggattaccaacgtccacatgcaacgcggtggactgagggagttggtgtctggtagtcgg
aacggcgaaatcagattgtgggatctgcgaatggatgaccccatctcgacagttcatgca
agcaaagacatagtccgaacattaagtgttcacgagcacgctcctgtcttcacggttggc
acgacccgccatgaagtcaagacattcaacatggatggcactcacctatccaccttcgag
ccatattcaagcttcctccaacacaaccgctcatctcctattgcaggcactgccttccac
ccacaccgcaccatacttgcctgcgctgcgcttcatgacaaccacatcaacctcatcagt
tgttaa

DBGET integrated database retrieval system