KEGG   Aspergillus clavatus: ACLA_093410Help
Entry
ACLA_093410       CDS       T01148                                 

Definition
dyrk
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ACLA_093410
Protein kinases [BR:act01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   ACLA_093410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1346 aa AA seqDB search
MGNLLKSEHTHTPPDRVDFLAPVNFDDFHNSIMTEPSLNHFPMPGNGGSKAANQAPGIFT
RNPWSENNEQSLSSRSRSNSIRRKSEVSRVSNPSSSAESVSSSSWAPAAHTAARSRRQSL
VQNAGVNGPVARAPRKSIGAGSLPPVISARRQSISARKASVDTASVDQMSLRPYTQHPVS
NGLDKTRLPSNVRNMKAKSLQPPSRDPRDNLLPTAGLTDHSRSCSTNAVRTPSKNPAGSA
LTPSSSAKRVSVMPPHATGLGARTISPTDAHRMKRMSIAPQAPPLPFTPPMKTDPMPIRP
RSSAHSPSSIPRKSVTPSSTRTTPDPNRKSYSSGLSLSSNTSYTSTRNSGSSLQSRLSQN
QSSSRLPTPKPRPEYTGGSHEEVPPVPAIPKAYESPKGDTEIQSYFAPRKSSLPVDTGLL
KSKHNQDSDNKSAASANEGITADKTDERGMKTPEAKTPASFGKKNLLPLKLPPLNLLPLS
TPVATKIQALKDREDDDQSSTPSNKVLSKTPSTPMTASKANFSFRNDDDGMGFTQARSST
SHFMLSTSSAVPSRTASSSSALASFDNSTGGARTISPYISYTLPKSSSEFGQLRQKANDS
GDYSPRISQSHKLNGPRPQTQSSAFSSNAETISQLSTPSDPDTNSVSGSSLLNRIALTRK
RSNSKSKHAVDADRDPTKQMPPPKLPASATWNTLSPVTTSSPTLKPAHAQARRQSSVSSA
TASTMRKPSFSSEHSLAALEPTPSNDSAESDGTSHRSTSSILSPVHKILYSGRSNTTASS
RHQETNVESDILVADEEMRRLASKRKGFEVAARNLDELRRKAGPKERVSPAQALQMANLN
IFERGEIIDFKDIYFCGTQTAKKHVGDLNAQSANFGYDDDRGDYNIVIGDHLAYRYEVVD
VLGKGSFGQVVRCIDHKNGALVAVKIIRNKKRFHQQALIEVNLLQKLKEWDPHRQHSVVN
FTQSFYFRGHLCISTELLGMNLYEFIKAHDFKGFHLKLIRRFTKQILSTLTLLHAKKVIH
CDLKPENILLVHPMSSEIRVIDFGSSCFENEKVYTYIQSRFYRSPEVILGMSYGMPIDMW
SLGCILAELYSGYPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRKKLFFDSLGKPRLTV
SSKGRRRRPSSKDLRQVLKCDDDPFLDFISRCLRWDPARRLTPHDALRHEFLTGIKLTSR
SRSYAAANLSNKRGTTLSNPTARPLPEPPGTSVKGGFIRSRDISGSSPIKQVGIGKRHST
VSGLQPSTPAKRGTATTNTPGSALPRVAARSISGKPDLATAAAATSLSLWFNDPITTLKV
LPNSHAYHFVFCFIACTLFPIILIPM
NT seq 4041 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacctcttgaaatccgagcacacgcatacacctcctgatcgcgtcgatttcctt
gcgcccgtcaacttcgacgattttcacaatagtatcatgacagagccaagtttgaaccat
ttcccaatgcctggaaatggaggatcgaaagctgcaaaccaagcccccggcatcttcacg
agaaatccatggtccgagaataacgagcagagcctctccagccggtcccgaagcaattcc
attcggaggaaaagcgaggtgtcacgcgtgtccaatccgagttcctcagccgaatcagta
tcatcatcctcatgggcgccagcggctcataccgccgcgcgaagtcgtcgtcagagtctg
gttcaaaatgctggtgtcaatggcccggtggcgcgggcaccacgtaaatcgatcggtgct
ggttctcttccgcccgtgatctctgcgagacgacaaagcatatctgctcgcaaggctagc
gttgacacggcttctgtcgatcaaatgagccttcgaccatatacccagcaccccgtttcc
aatgggttggacaagaccagacttccgtccaatgtcagaaatatgaaggctaaatcgctt
cagccgccttcgcgggatccccgtgacaatctattgccaacagctggattgacggatcac
tcccgatcatgctctaccaacgcggtgcggaccccgagcaagaaccctgctgggagtgca
ttgacgccctcttcgtccgccaaacgggtgtctgttatgccaccacacgctacaggtcta
ggcgctcgcactataagccctactgatgcacaccgtatgaaacggatgtctatcgcgccc
caggcgcctcccctgccttttacgcccccgatgaagacagatcccatgcctatccgccca
cggtcatccgcccactctccttctagcatcccacggaaaagtgtgactccgtcgtcgacg
cggactacacccgatccaaatcggaaatcgtacagttccggcctgtctctttcgtccaac
acaagttacacgtctacaaggaactctggtagctctctacagtccaggctatctcagaat
cagtcctcctcccgactacccacgcctaaaccgcgccctgagtacaccgggggaagccac
gaagaggtccctccggtcccggccattcccaaagcctatgagtctcctaaaggtgatacc
gagatccagagctattttgctccacgaaagtcgagtctgccagtggatacgggtctcttg
aaatctaaacacaaccaggattctgacaataaatcagcggcaagcgccaacgagggtatt
accgcagataagactgacgaacgaggaatgaaaaccccagaggccaagacgccggccagt
ttcggcaagaagaatctgttgccgttgaaacttcctcccttgaatctcttgcctctaagt
acccctgtcgccaccaagatccaagcactgaaggatcgagaagacgatgaccagtcgtcc
accccttcgaataaggttctctccaagacgcctagcacgccaatgacggcatccaaggcg
aacttttctttccgcaatgatgatgatggcatgggattcacccaggcccgaagcagcacg
tcacatttcatgctcagcacttcatctgctgtcccttcgaggacggcaagcagttccagt
gcattggcatctttcgacaacagtactggcggcgcaaggaccatttccccatacatctca
tataccttgccgaagagcagcagtgagttcggccagcttcgacagaaagccaatgacagt
ggagattactccccccggatctcccagtcgcacaaattgaatgggcctcgaccacaaaca
caatcctctgctttctcttcgaacgccgaaaccatcagccagctgtcaaccccttcggac
ccagataccaacagtgtctctggttcctcccttctgaataggatcgcattgactcgaaag
cgcagcaattctaaatcaaaacatgcggtggacgctgatcgagacccaacgaaacagatg
ccaccacccaaacttccggcctctgcaacctggaacaccttgtcaccagtcacaacttca
agccccacattgaagcctgcacatgcccaagcgaggcgccagtcttctgtttccagtgca
acggcttccacgatgagaaagcctagtttcagcagcgagcatagcctcgcggccctggag
cccactccttccaatgattcagctgaaagtgatggtacctcacaccgatcaacatcatca
atcctctcaccagtgcacaaaatcctatactcgggtcggtcaaacacaacggcgagctca
cgtcaccaggaaaccaatgtggagtctgacattctcgttgctgacgaggagatgcgccga
cttgctagcaaacgcaaaggcttcgaggtggcagcaaggaatctggatgaattacgtcgc
aaagccggtccaaaagagcgcgtgagtcccgcacaggcgctccaaatggccaatctcaac
atcttcgaacgcggggagatcattgatttcaaggatatctacttctgcggcacgcaaact
gccaagaagcatgtcggtgacctgaatgcgcaatccgcaaactttggatacgacgacgat
cgtggtgactataacatcgtgattggcgatcatcttgcgtatcgatacgaagtcgtagat
gtcctaggaaagggtagctttggtcaggtggtgagatgcattgaccacaaaaatggagct
ctcgtcgccgtgaagattattcgcaacaagaagaggttccatcaacaggcactaatcgaa
gtcaacctcctgcaaaaactcaaagaatgggatccacatcgccaacacagcgtggtgaac
ttcacccagagcttctacttcagagggcatttgtgcatctcgacagaactgctgggtatg
aatctctacgaattcatcaaggctcacgatttcaagggctttcatctcaagctcattcgc
cggttcacgaaacagatcctaagtacattgactctcttgcacgccaagaaggtcatccac
tgtgatcttaagccggagaacatccttcttgtccaccctatgagttcagagattcgggtc
attgatttcggatccagctgttttgagaacgagaaagtgtatacttatatccaaagtcgt
ttctaccgctctccggaggttatcttgggcatgtcctacggcatgccgattgacatgtgg
agtctaggctgtatcctggccgagctgtacagcggctatcccatctttccgggagagaac
gagcaggaacaactcgcctgtattatggaggtctttggccctcctgagaaacatctgatc
gagaagagtacccggaagaaattattttttgattccctgggcaagcctagactcacggtc
tcctcgaagggtagacggcgacgaccaagctcaaaggatctccgacaagtcttgaagtgt
gacgacgatccattcctcgatttcatctctcgttgtcttcgatgggaccccgctcgtcgc
ctgacccctcatgatgcactcagacacgaattcctcaccggaatcaaattgacatcgcgc
tctcggtcctatgccgcggcgaacttatcaaataagcgcggaaccaccctctctaaccct
acagcacggccgctcccagagccacccggcaccagtgtcaagggcggtttcatccggagc
cgagacatttcaggtagctctcccatcaagcaagttgggatcggcaagcgccactccact
gtgagcgggcttcaaccgtcaactcctgccaaacggggtacagcaaccaccaacacccct
ggatcagcactgccccgtgtcgcagccaggagcatcagtgggaagcctgatctcgcgact
gcggcggcggctacgagtctctctctatggttcaatgaccccatcacgaccctgaaggtt
cttccgaattcacatgcatatcactttgtcttctgcttcattgcctgcacattgtttcca
attatcctcatccccatgtaa

DBGET integrated database retrieval system