KEGG   Aspergillus clavatus: ACLA_094080Help
Entry
ACLA_094080       CDS       T01148                                 

Definition
Glycosyl hydrolase, family 15, putative
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
act  Aspergillus clavatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:act00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 642 aa AA seqDB search
MARGISFALWALSLGQSAFAAPNVSPRAGVGSLDSWLSAETTYSLNSILTNTGSNGAYAK
SAKPGIIIASPSLEGPNYYYTWTRDAALTMRVLIEEFRNGKIELQNVLKDYINSQAFLQT
VDNRSGGLASGGLAEPKYNVDMTAFTGDWGRPQRDGPALRATAMIDFGNWLIDNGYASYA
KDNIWPIVRNDLSYVAQYWPQSGFDLWEEINSMSFFTIAASHRSLVEGSAFAKRVGASCS
WCDSQAPQVLCYQQSFWTGSYMKANTGGGRSGKDANTVLASIHLFDPEAGCDDATFQPCS
PRALSNIKVFVDSFRGSLYPVNNGIPQGKAVAIGRYPEDVYYSGNPWFLTTLAVAEQLYD
AIYQWKKSGAITITSTSLPFFQELYSAASTRTYASSDPAFNAIIDSVKTYADGYVSIVQS
HSANNGSLSEQFDKTYGMSTSARDLTWSYAALLTANARRAGVVPPSWAAAQNNQIPGSCS
NSGATGTYQPAPINSWPVLSSGTPGTPGTTTTAATVGTSTTTTAPTSTTTGPGQCTVPTA
VSVTFDELAATAYGETILIVGSIPELGSWDATKAVALSATKYSASNPLWFVTIDLPAGKS
FEYKYIRKQTNGNVKWESNPNRSYKVPATCNTLTDVKNDTWR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtggtatttctttcgctctctgggcgctctccctcggccagagtgcctttgct
gcccccaatgtctctcctcgcgccggagttggttctctggactcttggttgtccgctgag
accacctactctctcaacagcattctcaccaacaccggatccaacggtgcctatgcgaag
agcgcgaagcctggtatcatcattgccagtcccagtctggagggtcctaattactactac
acctggactcgcgatgccgctctgaccatgagagtgttgatcgaggagttccgcaacgga
aaaatcgagcttcagaatgtgctgaaggactatataaactcgcaggctttcctccagacc
gtggacaaccgctctggtggtctcgccagcggtggtctggccgagcccaagtacaatgtg
gacatgaccgccttcactggtgactggggtcgtcctcagcgtgatggcccagctctgcgt
gccaccgccatgattgacttcggcaactggctgattgacaatggctatgccagctacgcc
aaggacaacatctggcccatcgtccgcaacgatctgtcgtatgtggcccagtactggccc
cagagcggctttgacctctgggaagaaatcaacagcatgtcctttttcacgatcgctgcc
tcgcaccgttccctcgtcgagggaagcgcctttgccaagcgcgttggcgcctcgtgctcc
tggtgtgactcccaggccccccaggttctctgctaccagcagagcttctggaccggctcc
tacatgaaggccaacactggcggtggccgctccggcaaggacgccaacaccgtcctggcc
agtatccacctgttcgaccccgaggctggctgcgacgatgccaccttccagccctgctct
ccccgcgctctctccaacatcaaggtctttgtcgattctttccgcggcagtctctacccc
gtcaacaacggtattccccagggcaaggccgttgccattggccgttaccccgaggatgtc
tactacagcggaaacccctggttcctgaccaccctggccgtcgccgagcagctgtatgac
gccatctaccagtggaagaagagcggcgccatcaccatcaccagtacttcgctgcctttc
ttccaggaactgtacagcgctgcttccacccgcacctatgcctcctcggacccggccttc
aacgcgatcatcgactcggtcaagacttacgccgacggctacgtcagcattgtgcaatcc
cactccgccaacaacggctccctctccgagcagttcgacaagacctacggcatgtccacc
tccgcccgcgacctgacctggtcgtacgccgctctcctgactgccaacgcccgccgcgcc
ggtgtcgtccccccgtcctgggccgcagcccagaacaaccagatccccggctcgtgctcc
aacagcggcgccaccggcacctaccagcccgccccgattaacagctggcccgtcctgagc
agcggcacccccggcacccccggcaccaccaccaccgccgcgactgttggcacctccacc
accaccaccgcgcccaccagcaccaccaccggccccggccagtgcaccgtccccaccgcc
gtgtccgtgaccttcgacgagctcgcggccaccgcctacggcgagaccattctcatcgtc
ggctccatcccggagctgggcagctgggacgccaccaaggccgtcgccctcagcgccacc
aaatacagtgccagcaaccccctgtggttcgtgaccatcgacctgcccgccggcaagagc
ttcgagtacaagtacatccgcaagcagaccaacggcaacgtcaagtgggagagcaacccc
aaccgctcctacaaggtgcctgccacctgcaacaccttgactgacgtcaagaacgatacc
tggcggtaa

DBGET integrated database retrieval system