KEGG   Aspergillus clavatus: ACLA_094550Help
Entry
ACLA_094550       CDS       T01148                                 

Definition
(RefSeq) beta-fructofuranosidase, putative
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
act  Aspergillus clavatus
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ACLA_094550
   00500 Starch and sucrose metabolism
    ACLA_094550
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ACLA_094550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 513 aa AA seqDB search
MRTHLLLISALVVAAQAVTYSGDLRPQVHFSPPANFMNDPNGLFYDSKREIYHLYYQYNP
YQTVAGNQHWGHATSPDLYHWTNHPIAISPSRSDEYIFSGSAVVDSNNTSGFFPGQDDGV
VAIYTLATAELQAQHIAYSTDGGYTFTKYEGNPVLDIGSSQFRDPQVVWHSETERWVMTI
AYADDRVIGFFTSPDLKEWTHASNFTQTGLPGTQFECPNLVRFSVGPVLPQENTKDVLFI
SVNPGAPLGGSGTFYVVGTFNGTHFVSETAHETLYDFGKDNYASQWYSGISEDEPPVSIG
WASNWNYTEQVPTGPLEGWRGAMTLPKVHTLTKVDGSWLVTQQPFDDLSSVRDKRLRAHV
AQNGDVTLDFKHVPSHAIYFDVRVDGISQSTSAGQVFFNFTSSKSGEYIDGGLNFNTGLF
WIDRAGTHLFTQANSSGYWPVFNTTLTAFEQSRFLFSGVIDRSLLEVFLDDGKQTGTMSF
YPASPLDTLTVFGRDLGEKIRFHVEAWGLESGW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcggactcatttgctgctcatctctgcccttgtggtagcagcccaggcagtgacttac
tctggagacctgcggccccaggtccacttctcccctccggcgaatttcatgaatgatccc
aacggacttttctacgacagcaagagagagatctatcatctttattatcaatataatccc
taccagactgtcgcgggtaatcagcactggggccatgccaccagcccagatctttatcac
tggactaaccatcccattgctatttcccccagcaggtcggatgagtatatcttctctggg
tccgctgtggtggacagcaataacacctcaggcttcttcccgggccaagatgacggtgta
gtggccatctacactctggcgactgcggaattacaagcgcaacacatcgcctactccacc
gatggcggatacacgttcaccaagtatgagggcaatcctgtgcttgatattggatccagt
caattccgcgaccctcaagttgtgtggcactcggagacggagcgctgggtcatgactatc
gcgtacgcagacgaccgtgtcattggatttttcacgtcgcctgatctcaaggaatggact
catgcttccaacttcacgcagactggattgccggggacgcagtttgaatgccccaacctg
gtcaggttctctgtgggtcctgtcctaccccaggagaacactaaggatgtgcttttcatc
tctgtcaatcccggcgcaccgctcggcggctcagggacgttttatgtcgtcggcacattc
aacggaactcattttgtctctgagactgcccatgaaacactctatgacttcggcaaagac
aactatgcctctcagtggtactcggggatttctgaggacgagcctcctgtctctattggg
tgggctagcaattggaattatactgaacaagtccccacaggcccgctcgaaggctggaga
ggcgcaatgaccctacccaaagtgcatactttgactaaagtcgacggatcctggctcgtc
actcagcaaccattcgacgacctgtcctccgtccgggataagcggttgagagcacatgtc
gctcagaatggcgatgtcaccctggacttcaaacatgtcccctcccatgcaatttacttc
gatgtgagggtcgatggcatctcgcaatccacatcggccggacaggtattcttcaacttc
acctcgtccaaatctggcgaatacatcgacggtggtctcaacttcaacacgggcctgttt
tggatcgatcgggcaggtacccatctcttcactcaggcaaatagctcagggtattggcca
gtcttcaacacgacccttacggcgttcgagcagagcaggtttttattctctggtgtcatc
gaccgctcacttctcgaggtattcctggatgacggaaagcagaccggcacgatgagtttc
tatccggcctcaccgctggatactctgacggttttcggcagggatttgggcgagaagatc
cggtttcatgttgaagcgtggggtttggagagcgggtggtga

DBGET integrated database retrieval system