KEGG   Aspergillus clavatus: ACLA_096170Help
Entry
ACLA_096170       CDS       T01148                                 

Definition
calcineurin regulatory subunit CalA
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
act  Aspergillus clavatus
Brite
Protein phosphatases and associated proteins [BR:act01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     ACLA_096170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 193 aa AA seqDB search
MEQPSEPNNAAMYDARRRRASVGTSQLLDNIVSASNFDRDEVDRLRKRFMKLDKDSSGTI
DRDEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKV
YDIDRDGYISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEADKDRDGKISFEEFTEMVE
NTDVSLSMTLNQI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacccagtgagcccaacaacgctgccatgtatgatgcgcgcaggcgcagagca
tctgtgggcacatcacagctgctcgataacatcgtgtctgcctccaacttcgatagggat
gaggtggatcggcttcgcaagcgatttatgaaactagacaaggatagctccggcaccatc
gatcgtgacgagttcctctccctcccccaagtatcgtccaacccgctggcgacgagaatg
atcgcgatcttcgacgaagacggtggcggcgatgtcgacttccaggaatttgtgtcgggt
ctgtcggcgttcagctccaagggcaacaaggaggaaaagctgcggttcgcgttcaaggtg
tacgatatcgaccgcgacggctatatttctaacggcgagctgtttatcgtgctgaagatg
atggtgggcaacaacctgaaggatgtgcagctgcagcagatcgtggacaagacgatcatg
gaggcggacaaggaccgcgacggcaagatcagcttcgaggagttcactgagatggtggag
aatacggatgttagcctgagcatgacgctgaaccaaatctaa

DBGET integrated database retrieval system