KEGG   Aspergillus clavatus: ACLA_097020Help
Entry
ACLA_097020       CDS       T01148                                 

Definition
malate synthase AcuE
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
act  Aspergillus clavatus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:act01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:act00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:act00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 539 aa AA seqDB search
MSQIEVQLKDVAILGAVNNEHRKILTKEACAFLAILHRTFNSTRKVLLQRRIDRQAEIDK
GHLPDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWENMINGQVNLYDAIRRQIDFKQGNKEYKLRTDRNLPTLIARARGWHLDEKHFT
VDGEPISGSLFDFGLYFFHNAKELVARGHGPYFYLPKMESHLEARLWNDAFNLAQDYIGM
PRGTIRGTVLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSFIKKFRKHPNFVLPDR
SDVTMTVPFMDSYVKLLIKTCHRRGVHAMGGMAAQIPIKDNAAANDKAMENVRADKLREV
RAGHDGTWVAHPALASIASDVFNKYMPTPNQLFVRREDVSITANDLLNTNVPGKITEDGI
RKNLNIGLSYMEGWLRGVGCIPINYLMEDAATAEVSRSQLWQWVYHQVTTSEGKKIDKAY
ALRLLQEQADSLAAKGPKGNKFQLAARYFAGQITGEAYADFLTSLLYNEISTPGTASKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatcgaggtacagctcaaggatgtcgccatcctgggcgccgtgaacaacgag
caccgcaagatcctcaccaaggaagcctgcgctttcctcgccatcctccaccgcaccttc
aactccacccgcaaagtcctgctccagcgccggatcgaccgccaggccgagatcgataag
ggccatctgcccgatttccttcccgagaccaagcacattcgcgagaatgacgcctggaag
ggtgctcctcctgcccccggtctcgttgaccgtcgcgtggagatcactggtcccacggac
cgcaagatggttgtgaacgcgttgaatgcggatgtctggacttacatggctgatttcgag
gattcgagcgcccccacctgggagaacatgatcaacggccaggtcaacctgtacgatgcc
atccgccgccagatcgacttcaagcaaggaaacaaggagtacaaactccgcaccgaccgc
aacctccccaccctgattgctcgtgctcgcggctggcatctggatgagaagcacttcacc
gtcgatggcgagcccatctccggctctctgttcgactttggtctctacttcttccacaac
gccaaggagctcgtcgcccgcggccacggcccttacttctacctgcccaagatggagtct
cacctcgaggctagactctggaacgatgcctttaacctcgctcaggactacattggcatg
ccccgcggcaccatccgtggtaccgtcctgattgagaccatcaccgccgccttcgagatg
gacgagatcatctacgagctgcgggaccacagctccggtctcaactgcggccgttgggat
tacatcttctccttcatcaagaagttccgcaagcaccccaactttgtcctccccgatcgc
tccgatgtcaccatgaccgttccgttcatggattcctacgtcaagctcctcatcaagacc
tgccatcgccgtggtgtccacgctatgggtggtatggctgctcagatccctatcaaggac
aacgccgcggccaacgacaaggctatggagaacgtccgtgccgacaagctgcgtgaggtc
cgtgccggccacgacggtacctgggtcgctcaccccgctctcgcctccattgcctccgac
gtcttcaacaagtacatgcccacccccaatcagctcttcgtccgccgcgaggacgtcagc
atcaccgccaacgacctgctcaacaccaacgtgcccggcaagattaccgaggacggtatc
cgcaagaacctgaacatcggtctctcctacatggagggctggctccgtggtgtcggctgc
atccccatcaactacctgatggaggacgctgctaccgccgaggtgtcccgctcccagctc
tggcagtgggtctaccaccaggtcaccacctccgagggcaagaagatcgacaaggcctac
gccctgcgtctgctgcaggagcaggccgacagcctcgctgccaagggccccaagggcaac
aagttccagctcgcggcccgctacttcgccggccagatcaccggtgaggcctatgcggat
ttcctgaccagcctgctgtacaacgagatctcgacccccggcactgcgtcgaaactgtga

DBGET integrated database retrieval system