KEGG   Aspergillus clavatus: ACLA_097560Help
Entry
ACLA_097560       CDS       T01148                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
act  Aspergillus clavatus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACLA_097560
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACLA_097560
Enzymes [BR:act01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ACLA_097560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 603 aa AA seqDB search
MFRTASRRIPRRLPTPSSTAGSPSRLALRSFACGYPRMSSSPLPTVEPPLSTALPSDSFQ
LLSSAEKAGAAEDALYEQQIRDVEAWWKSPRYEGIKRPYSAADVVTKRGTLQQTYPSSLM
ARKLFNLLSERAAEGKPVHTMGAIDPVQMTQQAPNQEVLYISGWACSSLLTTTNEVSPDF
GDYPYNTVPNQVQRLFKAQQMHDRKQWDTRRKMTPEQRKSTPYVDYMRPIVADGDTGHGG
LSAVLKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPMGEHINRLVAARFQWDMMG
AENLVIARTDSESGNLISSAIDVRDHEFILGVAEEVEPLAETLQAMEREGAAPAEIDAFE
LEWVKKHKLVTLDEAVDAHLAAEGAPQSARDAYKKKVQENPDLSISRRRVLANDYTKKPV
VWSCDSPRTREGFYHYRAGFPAATKRAKEFAPYADLLWVETGDPNVEKAGKLADEVRAVF
PGKKLVYNLSPSFNWMGQGFDEASLKSFVWDLAKHGFVLQLISLAGLHSNATITTELSRA
FKDEGMLAYVRLIQSREKELGVDVLTHQKWSGAPYMDGILGAIQSGSSSSKSMGEGNTEK
GKF
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaactgcttctcgtcgaattcctcgacgtcttcctaccccttcatcgactgct
ggcagtccttctcgtctcgccctgcgctcattcgcatgcggttatccgcggatgtcatca
tctccgcttccgaccgtcgagccccccctctcaacggccctgccatcagactcgtttcaa
ctgctgtcgtccgctgaaaaggccggagctgcagaggatgctctgtatgagcaacagatc
agagatgtagaggcttggtggaagtctcctcggtatgaggggatcaagagaccctactcg
gccgcggacgtggtcaccaagcgtggcacattacagcaaacgtatccgagctccctgatg
gctcgcaagctcttcaatctgctaagcgaaagagcagcagagggaaagccggttcataca
atgggtgccattgaccctgtacagatgacacagcaggctcccaaccaggaggttttgtac
atctctggctgggcgtgctcgtcgctcctgaccacgacaaatgaggtttccccggacttt
ggagattatccttacaatacagttccgaaccaggttcagcgattgttcaaggcccagcaa
atgcacgatcgcaaacaatgggataccagacgaaagatgacaccagagcaacggaaatcc
accccatatgttgattacatgagaccaatcgttgcagatggtgatactggccatggcggt
ctgtctgcagtcctcaagctagccaagctcttcgccgagaacggtgccgcggccgttcac
tttgaggatcagctccacggaggcaagaaatgcggccacctagcaggcaaggttctcgta
cccatgggagagcatatcaacagactcgttgctgctcgtttccaatgggacatgatgggt
gccgagaacctggtcattgcgcgcacagactcggagagcggaaacttgatcagcagtgcc
attgatgtccgcgatcacgagttcatcctgggagtggccgaggaggtcgagcctctcgca
gaaaccctgcaagcaatggagcgagagggtgccgcgcctgcggaaatcgatgcgtttgag
ctggaatgggtcaagaagcacaagctggtcactttagatgaagctgtggatgcccacctc
gccgctgaaggcgcgcctcagtccgctcgggacgcatacaagaagaaggttcaagagaac
cccgacctttccatctcgcgccgcagggtcctggcgaatgactacacaaagaaacccgtt
gtctggtcatgcgacagtcccagaaccagagaaggcttctatcactaccgtgccggcttc
ccagctgccacaaagcgcgcgaaggaattcgcaccctacgcggatctcctgtgggttgaa
acgggagatcccaacgtcgagaaggccggaaagctggcagacgaagtgcgcgccgtcttt
ccaggcaagaagcttgtctacaacctgagcccatcgttcaactggatgggccagggcttc
gatgaggcttcgctcaaatcatttgtctgggatctcgcgaagcacggcttcgtgctacaa
ctcatctcgctcgccggtctacacagcaacgccaccatcacgacggagctgtcccgcgcc
ttcaaggacgagggcatgctcgcctacgtgcgcctgatccagtcccgtgaaaaggaactc
ggcgtagacgtccttacccaccagaaatggagcggggcgccgtacatggacggcatcctc
ggagccatccagagcggcagcagcagcagcaagagcatgggagagggaaacactgagaag
ggtaagttctaa

DBGET integrated database retrieval system