KEGG   Actinoplanes sp. N902-109: L083_0764Help
Entry
L083_0764         CDS       T02655                                 

Definition
GluA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    L083_0764
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    L083_0764
Enzymes [BR:actn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     L083_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847862..850030
Genome map
AA seq 722 aa AA seqDB search
MRRTLTAVLVTAAAVLVAAGPADAHPQVTGTFSTGSSAWRPAPAVAAGGAADATVVVDPS
QTRQRYAGIGFSLDETSVSNLWKLTPAERERAIRLLVDPRTGAGLDRFRLTIGSPDLIEH
LPFWSYDDLPGGVAEDFGLRHFSIQRDVDLHIVDTIKLIQRYNPRATFFASAWSAPAWMK
TNNKFTGEVALLPGSTSSYYQVGKLRDDCIDVFARYYVKYVQAYARHGIKVDALTLLNEP
GMDVVYPAMDISIAQQQKLSVAIKRELGRAHLTTGLYVHDFNFWDWRDPGSTATKNYYRI
FDDPEAVRAADAIAFHPYWGDPRVMRTAYEQYGKPVHMTETSDLSPATILDYFRLDASSY
IMWAQTTDQDGGTLHWTDKRDNNVDWAEVGRTTKWPDRLVKVDTTTRTFTVRDELYAMGQ
FAKYLTPQHVRVESSATSTGISNVVFRNRDDYVAVLGNSTGTAEKVRIVVAGTSFVVTVP
AGSYATYRWTTHVPVHRNHAPELRPVGAVTADQYGTAHVQLSATDRDHDALAYYAVDLPD
GVTLDARTGLVTLTPTAAGTQNLTFFVTDGRARDQVEVPVTVVPRGAPVGVRVEAEAYTA
QHGWTDGGANFIENNAAASGGRNVGWTAAGNWLQYRIDVAEPGRYDVELRVANGSGAAAA
GAVSLRDATGSVLATADVPDTGGWATYQSVHTTADLAAGDQVVTVFCETGGFNLDYFRLS
RP
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcgcaccttgaccgcggtgctggtgaccgccgccgccgtgcttgtcgccgccggt
cccgcggacgctcatccgcaggtcaccggcacgttctccaccgggtcgagcgcgtggcgg
ccggcgcccgcagtcgcggccggtggcgccgccgacgccactgtggtggtggacccgagc
cagacccggcagcgttacgccggcatcggcttctcgctggacgagaccagcgtgtccaac
ctctggaagctcaccccggccgagcgtgagcgcgccatccggctgctggtggatccgcgg
acaggcgcgggcctcgaccggttccgcctgacgatcggcagcccggacctcatcgagcat
ctgccgttctggtcctatgacgatctccccgggggtgtggccgaggatttcggcctgcgg
cacttctccatccagcgtgatgtcgatctgcacatcgtcgacacgatcaaactcatccag
cgctacaacccgcgggcgacttttttcgcgtcggcgtggagtgctcccgcctggatgaag
accaacaacaagttcaccggtgaggtggcgctgctgcccggcagcaccagttcttactac
caggtgggcaagctgcgcgacgactgcatcgacgttttcgcgcgctactacgtcaagtac
gtccaggcgtacgcccggcacggcatcaaggtcgacgcattgacgctgctcaacgagccg
ggcatggacgtcgtctatccggccatggacatcagcatcgcccagcagcagaaactgtcg
gtcgccatcaagcgcgagctcggcagggcgcacctgaccaccggcctgtacgtgcacgac
ttcaacttctgggactggcgcgacccgggcagcaccgcgacgaagaactactaccgcatc
ttcgacgacccggaggcggtgcgggcggccgacgcgatcgccttccacccgtactggggt
gacccgcgggtgatgcgtaccgcgtacgagcagtacggcaagccggtgcacatgaccgag
accagcgacctgagcccggcgacaattctcgactacttccggctcgacgcgagttcgtac
atcatgtgggcgcagaccaccgaccaggacggcgggacactgcactggaccgacaagcgt
gacaacaacgtagactgggccgaggtcggccgcaccacgaaatggccggaccggctcgtc
aaggtcgacaccaccacgcgcacgttcacggtccgcgacgagctctatgccatgggccag
ttcgccaaatacctgaccccgcagcacgtacgggtggagtcgagcgccaccagcaccggc
atcagcaacgtggtcttccgcaaccgcgacgactacgtggccgtgctgggcaacagcacc
gggaccgccgagaaggtgcgcatcgtggtggccggcacctcgttcgtcgtgaccgtgccg
gccggctcctacgccacctaccgctggaccacgcacgtgccggtgcaccgcaatcacgct
cccgaactgcggccggtcggtgcggtgacggccgaccagtacggcaccgctcacgtgcag
ctgtccgccaccgatcgcgaccatgacgcgctggcctactacgcggtggacctgcccgac
ggggtgaccctggacgcgcgcaccgggctggtcacgctcacgccgacggccgccgggacg
cagaacctgacgttcttcgtcaccgacggccgggcgcgggaccaggtggaggtgccggtg
accgtggtgccgcgcggggccccggtgggcgtacgggtcgaggccgaggcatacacggca
cagcacggctggaccgacggtggggccaacttcatcgagaacaacgcggcggccagcggc
ggccggaacgtgggctggaccgccgccggcaactggctgcagtaccgcatcgacgtggcc
gagcccggccggtacgacgtggaactgcgggtggcgaacggctccggagccgcagctgcc
ggagccgtctcgctgcgcgacgcgaccggctcggtgctcgccaccgccgatgtgcccgac
accggtggctgggccacctatcagtcggtgcacacgacggccgacctggccgcgggcgac
caggtcgtcaccgtcttctgtgagaccggcggcttcaacctcgactacttccgcctgtcg
cgcccctga

DBGET integrated database retrieval system