KEGG   Actinoplanes sp. N902-109: L083_1380Help
Entry
L083_1380         CDS       T02655                                 

Definition
hypothetical protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    L083_1380
   00051 Fructose and mannose metabolism
    L083_1380
Enzymes [BR:actn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     L083_1380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1507041..1508228
Genome map
AA seq 395 aa AA seqDB search
MSVQPTRDDKFSFGLWTVGWTARDPFGDATRAPLDPVEAVHKLSELGAYGITFHDDDLVP
FGSDAQTRDGIIAGFKKALDETGMIVPMVTTNLFTHPVFKDGGFTSNDRSVRRYALRKVL
RNMDLAAELGAKTLVLWGGREGAEYDEAKDVQAALDRYAEGLNLLAQYSEDKGYGLRFAI
EPKPNEPRGDILLPTAGHAIAFVQELERSELFGINPEVGHEQMSNLNFAQGIAQALWHGK
LFHIDLNGQHGPKFDQDLVFGHADLLNAFALVDLLEHGAPGGGPGYDGPRHFDYKPSRTE
NYDGVWESAKANMRMYLLLKERAQAFRADPEVQAALADAKVLELAKPTLNEGETYQDLLN
DKSAFEEFDADAAGEQGYHMVKLHQLAIDHLLRAR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtccaacccacccgcgacgacaagttctccttcggcctctggaccgtgggatgg
accgcccgtgacccgttcggtgacgccacccgcgcgccgctcgacccggtcgaagccgtg
cacaagctctccgagctcggtgcgtacggcatcacgttccacgacgacgacctggtgccg
ttcggctcggacgcgcagacccgcgacgggatcatcgccggcttcaagaaggccctcgac
gagaccggcatgatcgtgccgatggtgaccaccaacctgttcacccaccccgtcttcaag
gacggcggtttcaccagcaacgaccgcagcgtgcgccgctacgccctgcgcaaggtgctc
cgcaacatggacctcgccgccgagctgggtgccaagacgctggtgctgtggggtggccgc
gagggcgccgagtacgacgaggccaaggacgtgcaggccgcgctcgaccgctacgccgag
ggcctgaacctgctcgcgcagtactccgaggacaagggctacggcctgcgcttcgccatc
gagcccaagcccaacgagccccgcggcgacatcctgctgcccacggccgggcacgcgatc
gcgttcgtccaggagctggagcgctccgagctgttcggcatcaaccccgaggtcggccac
gagcagatgtccaacctcaacttcgcgcagggcatcgcccaggcgctgtggcacggcaag
ctcttccacatcgacctgaacggccagcacggccccaagttcgaccaggacctggtgttc
gggcacgccgacctgctcaacgcattcgcgctggtcgacctgctggagcacggcgccccc
ggcggcggccccggctacgacggcccgcggcacttcgactacaagccctcgcgcaccgag
aactacgacggcgtgtgggagtcggccaaggccaacatgcggatgtacctgctgctcaag
gagcgtgcccaggcgttccgggccgaccccgaggtgcaggcggcgctggccgacgccaag
gtgctcgagctcgccaagccgaccctcaacgagggcgagacctaccaggacctgctcaac
gacaagagcgcgttcgaggagttcgacgccgacgcggcgggtgagcagggctaccacatg
gtcaagctgcaccagctcgcgatcgaccacctgttgcgggctcgctga

DBGET integrated database retrieval system