KEGG   Actinoplanes sp. N902-109: L083_1511Help
Entry
L083_1511         CDS       T02655                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    L083_1511
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    L083_1511
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    L083_1511
Enzymes [BR:actn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     L083_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1646041..1647612
Genome map
AA seq 523 aa AA seqDB search
MTSINRRSLLRAGLAGGLLSTFPAGSALAKGAQGMQAAAPGAPALSVAKSRPTLTHGVQS
GDATADSAIVWSRADRPGRLWVDVSRRPDLRGARRLRGPVVTPDTDLTGKARLRNLPSGE
RLYYSVRVESLDGHLSAPVTGQLSTAPTRRQDISFVWTGDVVGQGWGIDPAYGGLKIFES
MRRRRPDFLLHSGDTVYADGPLTAQVTLPDGRIWRNLLTEEKSKVAETLKEYRGQYAYNL
LDDAYKAFVAEVPQVNQWDDHEVLNNWYPGEILDDARYTEQRVDVLAARAHRAYHEWVPI
PSATGPVYRKISHGPLLDVFVLDMRTFKDPNDGDTYADPKRGLLGHAQREWLIKGLKSSR
ATWKVIANDLPLGIVVPDSPSGQEGVAQGDPGAPKGRELEFAQVLQAAHRAGVTGIVFLT
ADVHYSAAHHYDPARAAVQDFTPFWEFVSGPAHAGAFGPNALDGTFGPDTAFIHTPPVAN
ASPAEGYQHFGEVRIDGRTGDLRVDLRDRDGVSLWSTTLPAAR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgatcaatcgacgcagcctgctgcgagccggactggccggcggcctgctgagc
acgttcccggccggctcggccttggcaaaaggcgcccagggaatgcaggcggcggcaccg
ggtgccccggcgctgtccgtggcgaagagccgtcccacgctgacccatggcgtgcagagc
ggtgatgccaccgccgactctgccatcgtctggtcccgtgcggaccggcccggccggctg
tgggtggacgtgagccggcgtcctgacctgcgcggagcccgccggctgcggggacccgtg
gtcaccccggacaccgatctcaccggcaaggcgcggctgcgcaatctgccgtcgggcgag
cgcctctactactccgtacgggtggaaagcctggacggtcacctcagcgcgccggtcacc
gggcagctgagcacggctccgacccgcaggcaggacatctcgttcgtgtggaccggggac
gtggtggggcagggctggggcatcgaccccgcgtacggtggcttgaagatcttcgagtcg
atgcgccggcggcggccggacttcctgctgcacagcggcgacacggtctacgccgacggg
ccgctcacggcgcaggtgacgctgccggacggccggatctggcgcaacctgctgaccgag
gagaagtccaaggtcgccgagaccctcaaggaataccgcgggcagtacgcctacaacctg
ctcgacgacgcgtacaaggcattcgtcgccgaggtgccgcaggtcaaccagtgggacgac
catgaggtgctgaacaactggtaccccggggagatcctcgacgacgcccgctacaccgag
cagcgggtcgacgtgctggcggctcgcgcccaccgggcgtaccacgaatgggtgccgatc
ccgagcgcgaccggcccggtctaccgcaagatctcgcacgggccgctgctggacgtgttc
gtgctggacatgcgcacgttcaaggacccgaacgacggcgacacgtacgccgacccgaag
cgcggcctgctcggccacgcccagcgggagtggctgatcaaggggctgaagagctcccgg
gccacgtggaaggtgatcgcgaacgacctgccgctgggcatcgtggtgccggactccccg
agcgggcaggagggcgtggcgcagggcgacccgggcgcgcccaagggtcgtgagctggag
ttcgcccaggtgctgcaggccgcgcaccgggccggcgtgaccgggatcgtgttcctgacc
gccgacgtgcactacagcgccgcgcatcactacgacccggcgcgcgccgcggtgcaggac
ttcacgccgttctgggagttcgtgtccggccccgcgcatgccggtgccttcgggccgaac
gcgctggacggcacgttcggaccggacacggcgttcatccacacgccgccggtggccaac
gcgtcgccggccgaggggtaccagcatttcggtgaggtgcgcatcgacggccgtaccggg
gacctgcgggtcgatttgcgcgaccgcgacggggtgtcactctggagcacgacgctcccg
gccgcccgatag

DBGET integrated database retrieval system