KEGG   Actinoplanes sp. N902-109: L083_2385Help
Entry
L083_2385         CDS       T02655                                 

Gene name
aat3
Definition
aminotransferase YfbQ
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    L083_2385 (aat3)
   01230 Biosynthesis of amino acids
    L083_2385 (aat3)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L083_2385 (aat3)
   00290 Valine, leucine and isoleucine biosynthesis
    L083_2385 (aat3)
Enzymes [BR:actn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     L083_2385 (aat3)
    2.6.1.66  valine---pyruvate transaminase
     L083_2385 (aat3)
Amino acid related enzymes [BR:actn01007]
 Aminotransferase (transaminase)
  Class I
   L083_2385 (aat3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2573293..2574501)
Genome map
AA seq 402 aa AA seqDB search
MVAQASRLKNVRYDIRGPVLQRAQELENAGHRILKLNLGNPAPWGLATPEPIVADMVHNL
GVAEGYSDARGIYSARVAVAQYYQTLGVRDVQPDDVFLGNGVSELIVMSLQALLNTGDEV
LVPSPDYPLWTGAVTLCGGRPVHYRCDESAGWEPDLEHVAAQITPNTRAMVIINPNNPTG
AVYSRETLLGLLDIARRHDLLVLADEIYDKILYDDARHECAAALAPDLLILTMSGLSKAY
RAAGFRSGWMAVSGPTTHAGEYLEGLQLLANMRLCPNVPAQHAVQTALGGFQSINTLIRP
GGRLYEQRTHAYHKLNEIPGVDAVLPRGALYLFARLDPQVHKIRDDQKLIIDLLEQELML
LSHGTGFNLPTPDHLRLVFLAPVDVLDDAANRLARFLETYQQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgcaggcgagcaggctcaagaacgtccggtacgacatccggggacccgtgctg
cagcgggcccaggagctggagaacgcggggcatcgcattctcaagctcaacctgggcaac
cccgcgccgtgggggctggccacccccgagccgatcgtcgccgacatggtgcacaacctg
ggcgtggccgagggctacagcgacgcccggggcatctactcggcacgggtcgcggtcgcg
cagtactaccagacgctgggcgtgcgggatgtccagccggatgacgtgttcctcggcaac
ggggtgtccgagctgatcgtcatgtcgctgcaggcgctgctgaacaccggcgacgaggtg
ctggtgcccagtcccgactacccgctgtggaccggcgcggtgaccctgtgcggcgggcgg
ccggtgcactaccgctgcgacgagtcggccggttgggaaccggacctggagcacgtggct
gcgcagatcaccccgaacacccgcgcgatggtcatcatcaaccccaacaacccgaccggt
gccgtctactcgcgggagaccctgctcggcctgctggacatcgcccggcggcacgatctg
ctggtgctcgccgacgagatctacgacaagatcctgtacgacgacgcgcggcacgaatgc
gcggcggcgctcgccccggacctgctgatcctgacgatgagcgggctgtcgaaggcgtac
cgggcggcgggcttccgctcgggctggatggccgtcagcggccccaccacccatgccggc
gagtatctcgaaggactgcaactgctcgccaacatgcggctctgcccgaacgtgcccgcc
cagcacgcggtgcagacggcgctcggcggtttccagagcatcaacacgctgatccgcccc
ggcggcaggctctacgagcagcgcacccacgcctaccacaagctcaacgagattcccggc
gtcgacgccgtcctgccccgcggtgccctgtacctgttcgcccggctcgacccccaggtc
cacaagatccgcgacgaccagaagctcatcatcgacctgctcgaacaggaactcatgctg
ctgtcccacggcaccggcttcaacctccccacccccgaccatctgcgcctggtcttcctc
gccccggtcgacgtcctcgacgacgccgccaaccgcctggcccgcttcctggagacctac
cagcagtag

DBGET integrated database retrieval system