KEGG   Actinoplanes sp. N902-109: L083_3086Help
Entry
L083_3086         CDS       T02655                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase family protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
actn  Actinoplanes sp. N902-109
Brite
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     L083_3086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3686288..3687034
Genome map
AA seq 248 aa AA seqDB search
MTWYRALVTAEIVLAVITFAALRFTTAPYGRHARDGWGVTVPARAGWLVMESVSPLVFAA
VFWAGPRRADGVALLLFGMWQTHYVYRAFWFPLLLRGGKRMPLAVVLLAIGFNVLNAGVN
AYWVGRLGRYPGSWPADPRFLIGAVLFAGGLATHVWADRKLRGLRTTTGSGYRIPYGGLY
RWVSCPNYLGEMVQWAGWALATWSPAGLAFALYTVANLAPRAIDHHAWYHRCFPEYPARR
RALVPYVI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgtggtatcgcgcgctggtcaccgcggagatcgtgctggctgtgatcacgttcgcc
gcgctgcggttcacgacggcgccgtacggccggcatgcgcgtgacgggtggggtgtcacg
gtgccggcgcgggccggctggctggtcatggagagcgtctcgccgctggtgttcgcggcc
gtgttctgggccgggccgcggcgggccgacggggtggcgctgctgctgttcgggatgtgg
cagacccactacgtctaccgtgctttctggtttccgttgctgctgcggggcgggaagcgg
atgccgctcgcggtggtgctgctcgccatcgggttcaacgtgctcaacgccggggtcaat
gcgtactgggtcggccggctcggccggtatcccggcagctggccggccgatccgcggttc
ctgatcggcgcggtgctgttcgccggtggtctggcgacgcatgtgtgggccgaccggaaa
ctgcgcgggctgcgcacgacgaccggcagcggctaccggatcccgtacggcggtctgtac
cgctgggtgtcctgcccgaactacctcggcgagatggtgcagtgggccggctgggcgctg
gccacgtggtcgccggcggggctggcgttcgccctgtacacggtggcgaacctggcaccc
cgggcgatcgaccaccacgcctggtaccaccggtgcttcccggagtacccggcgcggcgg
cgcgcgctggtgccgtacgtcatctga

DBGET integrated database retrieval system