KEGG   Actinoplanes sp. N902-109: L083_3175Help
Entry
L083_3175         CDS       T02655                                 

Gene name
cel1
Definition
(GenBank) glycoside hydrolase family protein
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L083_3175 (cel1)
Enzymes [BR:actn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     L083_3175 (cel1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3773355..3776405
Genome map
AA seq 1016 aa AA seqDB search
MTPHLRRRVTMLTAAATAAMLALTSLTANPASAEPAQLIANGDFATGTTGWWSTDNAPIS
AAGGELCADVPGGTTNAWDVSLGYNDVPLVAGAAYRLSFRAHADAPVTVRANVQLNEDPY
TAALSRSVALTTAAQTFDSSFTSSLQSANGTLTFQLGGSAQAFRFCLDDVSLTSDTAAPP
AGAEQLENGDFSDGTAGWYSYGTTATGVDDGQLCTTVPGGLANPWDAGIGQNNVTLQAGS
AYTLSFDATASPGATVRAAVQLGADPYTSYLSRDVALTPARQHLEYTFTASEDTTAGQVA
FQVGGAAAEYRLCLDNVSLTGGEAEPPYVPDTGPRVRVNQVGYLPAGPKNATLVTDATTA
LDWQLKNAAGSVVRSGRSTPRGVDAASGQNVHTIDFTGYTTAGTGYTLVADGQTSHPFDI
SGTVYERLRPDALQFFYIQRSGIAIDGGLVGEQYARPAGHLGVAPNKGDTDVPCRANTCD
YRLDVRGGWYDAGDQGKYVVNGGIAVQQLMSSFERTKTAVTAAHGAGLADSTLRVPERGN
KVPDILDEARWELEFLMRMQVPAGQPLAGMAHHKMHDANWTGLPMQPQDDPEQRELQPPS
TAATLNLAATTAQCARLFAPYDATFAAKCLTVARTAYAAAKANPAKLAQDLGGGGGSYGD
DDVSDEFYWAAAELYLTTGEAAFLTDVTASRHHTGDVFAATGFGWASTAALGRLDLATVP
SALPAADRERVRQSVLTAADGYLATVGAQAYGLPMPGNAGAYFWGANSNILNNVQVLATA
FDMTGAAKYRDAAVQGVDYIFGRNALNQSYVTGWGEKASENQHTRIYAHEKDAALPHPPA
GSLAGGANAGLDDPYAKSLLTGCKPMFCYVDDIESYATNELAINWNSALAWVASFLADQG
RGEPAAAVSCRATYTNYGDWADKSGFTAQLAVTNTGTKAIDGWAVRFAFLGGQKVRDAWS
AEATQSGATVTAKNLAANQRIQPGATVYFGFNATTPGGPNPAPELITLNGSACGRS
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
gtgactccacacctgcgtaggcgggtcaccatgctgacggcggccgccacagcggccatg
ctggcactcacatccctgacggcaaaccccgcgtcggccgaaccggcgcagctcatcgcc
aacggcgacttcgccaccgggacgaccggctggtggtccaccgacaacgcgccgatctcc
gcggccggcggcgagctctgcgcggacgtacccggcggcaccaccaacgcctgggatgtc
agcctcggctacaacgacgtaccgctggtcgccggcgcggcctatcggctcagcttccgt
gcgcatgccgacgcgccggtgaccgtccgggccaacgtgcagctcaacgaggacccgtac
accgcggcgctgtcccggtcggtggcgctgaccaccgcggcgcagaccttcgactcgtcg
ttcacctccagcctgcagtcggccaacggcacgctgacgttccagctcggcgggtctgcc
caggcgttccggttctgcctcgacgacgtgtcgctgaccagtgacaccgccgcgccgccg
gccggtgccgagcagctggaaaacggcgacttcagcgacggcaccgcgggctggtactcc
tacggcaccacggcgaccggggtcgacgacggacagctgtgcacgacggtgcccggtggg
ctggccaacccctgggacgccggcatcgggcagaacaacgtgacgttgcaggccgggtcg
gcgtacacgctgtcgttcgacgcgacggccagccccggtgccaccgtgcgggccgccgtt
cagctgggcgccgacccgtacacctcgtacctgagccgggatgtcgccctgaccccggcc
cggcagcacctggagtacacgttcaccgcgtccgaggacaccaccgcgggtcaggtcgcc
ttccaggtcggtggcgccgccgcggagtaccggctgtgcctggacaacgtgtcgctgacc
gggggcgaggccgagccgccgtacgtgccggacaccgggccccgggtgcgggtcaaccag
gtcggctacctgccggccggcccgaagaacgccaccctggtcaccgacgccaccacggcg
ctggactggcagctcaagaacgcggccggcagcgtggtcaggtcggggcgcagcacgccg
cgcggggtggacgccgcctcgggccagaacgtccacaccatcgacttcaccggctacacc
accgcgggtacgggctacacgctggtcgccgacggccagaccagccacccgttcgacatc
tccggcaccgtctacgagcgactgcgcccggacgccctgcagttcttctacatccagcgc
agcggcatcgccatcgacggcgggctggtcggcgagcagtacgcccggcccgccggtcac
ctgggcgtggcacccaacaagggcgacaccgacgtgccgtgccgggcgaacacctgcgac
taccggctggacgtgcgcggcggctggtacgacgccggtgaccagggcaagtacgtggtc
aacggcgggatcgccgtgcagcagctgatgagcagcttcgagcgcaccaagaccgcggtc
accgcggcgcacggtgccgggctggccgacagcacgctgcgggtgcccgagcggggcaac
aaggtccccgacatcctcgacgaggcccgctgggagctggagttcctgatgcgcatgcag
gtgccggccggtcagccgttggccgggatggcgcaccacaagatgcacgacgccaactgg
accggcctgccgatgcagccgcaggacgaccccgagcagcgcgagctgcagccgccgtcg
accgcggccacgctcaacctggcggccacgaccgcccagtgcgctcggctgttcgccccg
tacgacgcgacgttcgcggccaagtgcctcaccgtggcgcgcaccgcgtacgcggcggcc
aaggccaacccggcgaagctggcgcaggacctgggtggcggcggtggcagctacggcgac
gacgacgtgtccgacgagttctactgggccgccgccgagctgtacctgaccaccggggaa
gcggcgttcctgaccgatgtgaccgcgtcccggcaccacaccggcgacgtcttcgcggcc
accggcttcggctgggccagcaccgcggcgctgggccggctggacctggcgacggtaccg
agcgcactgccggccgccgaccgggaacgggtccggcagtcggtgctcaccgccgcggac
ggttacctggcgacggtcggcgcccaggcgtacgggctgccgatgccgggcaacgcgggg
gcctacttctggggcgccaacagcaacatcctcaacaacgtccaggtgctggcgaccgcg
ttcgacatgaccggtgcggccaagtaccgggacgcggcggtgcagggtgtggactacatc
ttcgggcgtaacgcgctgaaccagtcgtacgtcaccggctggggcgagaaggcgtcggag
aaccagcacacccggatctacgcccacgagaaggacgccgcgctgccgcacccgccggcc
gggtcgctggccggcggcgcgaacgccgggctggacgacccgtacgccaagagcctgctc
accgggtgcaagccgatgttctgctacgtggacgacatcgagtcgtacgcgaccaacgag
ctggccatcaactggaactccgccctggcctgggtggcgtccttcctggccgatcagggc
cggggtgagccggctgcggcggtgtcctgccgggctacctacaccaactacggcgactgg
gcggacaagagcgggttcaccgcgcagctggccgtcaccaacaccggcaccaaggccatc
gacggctgggccgtgcgcttcgccttcctcggcggtcagaaggtacgcgatgcgtggtcg
gccgaggcgacccagtccggcgccacggtgacggccaagaacctcgccgcgaaccagcgc
atccagcccggggcgacggtgtacttcggcttcaacgccacgacgccgggcggacccaac
ccggcgccggagctgatcaccctgaacgggtcggcctgcggccggtcctga

DBGET integrated database retrieval system