KEGG   Actinoplanes sp. N902-109: L083_3295Help
Entry
L083_3295         CDS       T02655                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    L083_3295
  Energy metabolism
   00680 Methane metabolism
    L083_3295
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    L083_3295
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     L083_3295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3921176..3922318
Genome map
AA seq 380 aa AA seqDB search
MKAVVYQGPRDVAIKEVPDPSVQDPTDAIVRITTTNICGSDLHMYEGRTSVEQGTVLGHE
NMGIVEAVGGAVNRIKVGDRVSVPFNIACGSCRNCVAGWTSFCLRTNPAEGMDGAAYGYA
NMGPYDGGQAEYLRVPYADFNLLELPAGSEHENDFTMLSDIFPTGWHGTELAGLQPGDRV
AVFGGGPVGLMAAHSAMIRGASQVFVVDKEKDRLDLAGTIGATPVDFAQGDPVEQILDAT
GGRGADCGVEAVGYQAHDPSGQEHPELVLDNLVKVVRSTGGIGVVGVYLPQDPGAATEQA
KQGRVAFDYGTFFSKGQRMGTGQCPVMRYNRHLRDLIITGRAQPSFLVSHELPLDEAAEG
YQHFDKREAGWTKVLLRPAA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtggtctatcagggaccccgggacgtcgcgatcaaggaggtcccggatccg
tcggtccaggatccgacggatgcgatcgtacggatcaccaccaccaacatctgcggctcg
gacctgcacatgtacgagggccgcacctcggtcgagcagggcaccgtcctcggtcacgag
aacatgggcatcgtcgaggcggtcggcggcgcggtgaaccggatcaaggtcggcgaccgg
gtgtccgtaccgttcaacatcgcctgcggcagctgccgcaactgcgtcgccggctggacc
agcttctgcctgcggaccaacccggccgaggggatggacggcgccgcctacggctacgcc
aacatgggtccgtacgacggtgggcaggccgagtacctccgggtgccctacgcggacttc
aacctgctggaactgccggcgggcagcgagcacgagaacgacttcaccatgctgtcggac
atcttcccgaccggctggcacggcaccgagctggccgggctgcagcccggcgaccgggtg
gcggtcttcggtgggggaccggtgggtctgatggcggcgcacagcgcgatgatccgcggg
gcgtcgcaggtgttcgtggtggacaaggagaaggaccggctcgacctggccggcacgatc
ggtgcgacgccggtggacttcgcccagggtgacccggtggagcagatcctcgacgccacc
ggcgggcgcggcgccgactgcggcgtcgaggcggtcggctaccaggcgcacgacccgtcc
gggcaggagcacccggagctggtgctggacaacctcgtcaaggtggtccggtcgaccggc
gggatcggcgtggtcggggtgtacctgccgcaggaccccggcgccgcgaccgagcaggcc
aagcagggccgcgtcgccttcgactacggcaccttcttcagcaagggccagcggatgggc
accggccagtgcccggtgatgcgttacaaccggcacctgcgcgatctgatcatcaccggc
cgtgcccagccgtcgttcctggtctcgcacgagctgccgctggacgaggcggccgagggc
taccagcacttcgacaagcgcgaggccggttggacgaaggtgctgctgcgccccgccgcc
tga

DBGET integrated database retrieval system