KEGG   Actinoplanes sp. N902-109: L083_3437Help
Entry
L083_3437         CDS       T02655                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    L083_3437
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L083_3437
   00620 Pyruvate metabolism
    L083_3437
   00650 Butanoate metabolism
    L083_3437
  Lipid metabolism
   00071 Fatty acid degradation
    L083_3437
  Amino acid metabolism
   00350 Tyrosine metabolism
    L083_3437
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    L083_3437
   00626 Naphthalene degradation
    L083_3437
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     L083_3437
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     L083_3437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4091900..4094479
Genome map
AA seq 859 aa AA seqDB search
MGTAATMTTSIDTLVSNGLQALAEYAGFTQERVDAIVARASVAALHEHGRLAQLAIEDTG
RGVFEDKAAKNMFAAERVAHSMAGVKTVGVIRRDEVNGIVEIADPVGVVAGITPVTNPTS
TTIFKALLALKTRNPIVFAFHPGAQACSEAAARVVRDAAVAAGAPQHCVQWIAEPSLAAT
TELMRHPDIAVILATGGNGMVRAAYSAGKPALGVGAGNVPAYVHSSADVGRAVHDIVVSK
TFDNGMICASEQAVILDETVYDRALAEFERLHAHLATAAEKQLLEQFLFPSGDALTTAAV
GRSAQWIAQQAGFTVPKDTSVILAPVTEVGPAEPLTREKLCPVLALIRSAGAEQGLRYAE
EMIEFHGLGHSAAVHSTDADFVTEFGRRVKAVRVIWNAPASQGGIGDIYNAYLPSMTLGC
GSYGRTSVSGNVSAVDLINIKRIGRRTNTMQWFKIPPKIYFEPYSIRYLGDMPGVSRVSI
VTDPAMTHLGYVDRISEVLRGRPEPVTIQVLDSIAAEPTMDEVQAGAAALRAFKPDTIIA
LGGGSPMDAAKVMWLLYEYPDAGFADMREKFSDIRKRAFRFSVPGKLARLVCIPTTSGTG
AEVTPFAVITDPADGQKYPLADYALTPSVAIVDPALTAQLPPAVTADSGFDALTHATEAY
VSVYASDFTDGLALHAIRLIFEHLERAVRSGGADPVAREKMHNAGTIAGLAFGNAFLGVV
HAMAHTLGARFHLPHGRTNAILLPHVIRYNGTVPEKPTAWPKYERYTAPERYQDIARMLG
LPAGTPEQAVESYATAVERLREAVGIPATLRAAGVPEDQFRAALPQQAMNAYLDQCAPAN
PRTPMIDEMQALMLRAYEG
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccgcagcaacgatgacgaccagtatcgacaccctcgtcagcaacggtctgcag
gcgctcgccgagtacgccggcttcacccaggaacgggtcgacgcgatcgtcgcccgggcc
tccgtggcggcgctgcacgagcacggccgcctggcccagctggcgatcgaggacaccggc
cgcggcgtgttcgaggacaaggcggccaagaacatgttcgccgccgagcgagtcgcgcac
agcatggcgggcgtcaagacggtgggtgtgatccggcgcgacgaggtcaacggcatcgtc
gagatcgccgacccggtgggtgtggtcgccgggatcacgcccgtgaccaacccgacctcg
accaccatcttcaaggcgctgctggccctcaagacccgcaacccgatcgtcttcgcgttc
cacccgggcgcgcaggcgtgcagtgaggctgctgcgcgggtggtgcgggacgccgcagtg
gccgccggtgccccgcagcactgtgtgcagtggatcgccgagccctcgctggccgccacc
accgagctcatgcggcaccccgacatcgcggtcatcctggccaccgggggcaacggcatg
gtgcgcgcggcctactcggccggcaagcccgcgctgggcgtgggcgccggcaacgttccc
gcgtacgtgcacagcagcgccgacgtcggccgggcggtgcacgacatcgtggtgtccaag
accttcgacaacggcatgatctgcgcctccgagcaggcggtcatcctggacgagacggtg
tacgaccgggccctggcggagttcgaacggctgcacgcccatctggccaccgccgccgag
aagcagctgctcgagcagttcctcttcccgtccggcgatgcgctcaccaccgcggcggtc
ggccggtccgcgcagtggatagcgcagcaggccggtttcaccgtgccgaaggacacgtcg
gtgatcctggcgccggtgaccgaggtgggcccggccgagccgctgacccgcgagaagctc
tgcccggtgctggccctgatccgctcggccggcgccgagcaggggctgcggtacgccgag
gagatgatcgagttccacgggctggggcacagcgccgccgtgcacagcaccgacgccgac
ttcgtcaccgagttcggccggcgggtcaaggccgtacgggtgatctggaacgccccggcg
tcgcagggcggcatcggcgacatctacaacgcctatctgccgtcgatgaccctgggctgc
ggcagctacgggcgtacctcggtgtccggcaacgtctccgccgtcgacctgatcaacatc
aagcggatcggccggcgcaccaacaccatgcagtggttcaagatcccgccgaagatctac
ttcgagccgtactcgatccgctacctcggcgacatgcccggggtgagccgggtcagcatc
gtcaccgacccggcgatgacccacctcggctatgtcgaccggatcagcgaggtcctgcgg
ggccggcccgagccggtgaccatccaggtgctcgactccatcgccgccgagcccaccatg
gacgaggtacaggccggcgcggcggcgttgcgggcgttcaagcccgacaccatcatcgcg
ctgggtggcggctcgcccatggacgcggccaaggtgatgtggctgctgtacgaatacccg
gacgccgggttcgccgacatgcgggagaagttctccgacatccgcaaacgcgcgttccgg
ttctccgtaccggggaagctggcccggctggtgtgcatcccgaccacctccggtacgggc
gcggaggtcaccccgttcgcggtgatcaccgacccggccgacggtcagaagtacccgctc
gccgactacgcgctcacccccagcgtggccatcgtggacccggccctgaccgcccagctg
cccccggcggtcaccgcggacagcggcttcgacgcgctcacccatgccaccgaggcgtac
gtgtcggtgtatgccagcgacttcaccgacgggctggccctgcacgcgatccggctgatc
ttcgagcacctggaacgtgcggtgcggtccggcggcgccgacccggtggcccgggagaag
atgcacaacgccggtacgatcgcgggcctggcgttcggcaacgccttcctcggcgtcgtg
cacgcgatggcacacaccctgggtgcccgcttccacctcccgcacgggcgcaccaatgcg
atcttgctgccgcatgtcatccggtacaacggcacggtacccgaaaagccgaccgcatgg
cccaagtacgagcggtacaccgcacccgagcgctaccaggacatcgcccggatgctcggg
ctgccggccgggacgccggagcaggcggtggagtcgtacgcgaccgcggtggaacggctg
cgcgaggccgtcggcatcccggcgacgctgcgggccgccggcgttccggaggaccagttc
cgcgcggcgttgccgcagcaggcgatgaacgcctatctcgaccagtgcgccccggcgaac
ccgcggaccccgatgatcgacgagatgcaggcgctgatgctgcgcgcctacgagggttga

DBGET integrated database retrieval system