KEGG   Actinoplanes sp. N902-109: L083_3524Help
Entry
L083_3524         CDS       T02655                                 

Definition
putative alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    L083_3524
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    L083_3524
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    L083_3524
Enzymes [BR:actn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     L083_3524
Exosome [BR:actn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L083_3524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4184463..4185716
Genome map
AA seq 417 aa AA seqDB search
MDVRNSRWLVPVLAGALITGGLTLTRPAAPPASAAAVRNVIFINGDGMAAAHREAARLYY
AGLDGRLVMDSLPVSGQLTTSPHDPGSVVTDSAAGASAWATGQRTYNGAISVDVAGNPLP
TLGAQAKAAGKATGLVTTAQVTDASPAAFFSNSVNRAAQDDIARQYLEVSKPDVILGGGE
DWWLPAGSPGAYPDQPAADPAEGSRGTKGDLIAQARRAGYRYVSTAAQLGSARGGKLLGL
FANEELFQQRPEGQGDVYDPPVSLATMTSKALSTLGPARHGFFLFVEEEAVDEFAHNNNG
RRTLQAMGELEKAVTVARDYAATHRDTLVVVTGDHETGGLAVEDPGVTGDESGDGVSAED
GPFPVKGSGLSFAIDWTTGEHTGQNVPVTAYGPQSGRFTGQHPNTYVYDVLEPMVTG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggacgtccgtaacagtcgatggctcgtgccggtgctggccggggccctgatcaccggt
ggactcacgctgacccgcccggcggctccaccggcgtcggccgccgccgtacgcaatgtc
atcttcatcaacggtgacggcatggccgccgcgcatcgcgaagccgcccggctctactac
gccggtctcgacggccggctggtgatggattcgctgccggtgtccgggcagctcaccacc
agcccgcacgacccgggctcggtggtcaccgactcggccgccggggccagcgcctgggcc
accgggcagcgcacgtacaacggtgccatcagcgtcgacgtggccggaaacccactgccc
acgctgggcgcccaggccaaggcggccggcaaggccaccggcctggtcaccaccgcccag
gtgaccgacgccagcccggccgcgttcttctccaacagcgtcaaccgggccgcgcaggac
gacatcgcacggcagtacctggaggtcagcaagcccgacgtgatcctcggcggcggggag
gactggtggcttccggcgggcagcccgggtgcgtacccggaccagccggccgccgacccc
gccgagggcagccggggcaccaagggtgatctgatcgcgcaggcccgccgggccggctac
cgctacgtctcgaccgccgcgcagctcgggtcggcccgcggcggcaagctgctcggactg
ttcgccaacgaggagttgttccagcaacggccggagggccagggcgatgtgtacgacccg
ccggtcagcctcgcgaccatgaccagcaaggccctcagcacgctcggccccgcccggcac
gggttcttcctgttcgtcgaggaggaggcggtcgacgagttcgcgcacaacaacaacggc
cggcgcaccctgcaggcgatgggcgagctggagaaggcggtcacggtggcccgggactac
gccgccacgcaccgcgacacgctggtggtcgtgaccggtgaccacgagaccggcgggctg
gccgtcgaggacccgggggtcaccggggacgagtccggcgacggcgtctcggccgaggac
gggccgttcccggtcaagggcagcgggctcagcttcgccatcgactggaccaccggcgag
cacaccggccagaacgtcccggtcaccgcgtacgggccgcagtccggccggttcaccggc
cagcaccccaacacctatgtgtacgacgtcctcgagcccatggtgaccggatag

DBGET integrated database retrieval system