KEGG   Actinoplanes sp. N902-109: L083_3663Help
Entry
L083_3663         CDS       T02655                                 

Gene name
bglC
Definition
endoglucanase CelA
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L083_3663 (bglC)
Enzymes [BR:actn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     L083_3663 (bglC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4364761..4366245
Genome map
AA seq 494 aa AA seqDB search
MRKTKLKLLIAGAVAAAASAVALIAIPASAQTAAFTVTNSWSTGYQASVVVKNDTSNTLP
TWKVEVTLPAGSAVVNSWNAIQAGSGSSYTFTPAGWNATVAAGASVEFGMIVSGTGRPTS
CTVNGSDCGVATSPTTVPASTAPATTTPTSKPATTAPTTKPATTAPTTAPATTAPTTAAP
ATGTPVGINGQLHVCGVNLCNQYDKAIQLRGMSTHGLQWFPDCYTNASLDALANDWNADL
LRIAMYVQEGGYETDPSGFTGKVNTLVDMAEARGMYALVDFHTLTPGDPNVNLDRARTFF
AAVAKRNAAKKNVIYEIANEPNGVSWTAVKSYAEQVIPVIRANDPDAVVIVGTRGWSSLG
VSDGSNSSEVIANPVKASNIMYTFHFYAASHKDNYRAEVQKAAASLPLFVTEFGTVSASG
GGAVDTAGSTAWLDLLDKLRISYANWTFSDANEGSAALKPGTCASGSFTGTGALTESGAL
IRSRIRTADNFPVG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagacgaaactcaagcttctgatcgccggtgcggttgccgcggcggcgtcggcg
gtggcgctgatcgccatcccggcgtccgcgcagaccgccgccttcaccgtgaccaactcg
tggagcaccggctaccaggcgagtgtggtggtcaagaacgacacctcgaacaccctcccg
acgtggaaggtggaggtgacgctgccggccggttcggcggtggtcaactcgtggaacgcc
atccaggcggggtccggcagcagctacacgttcaccccggcgggctggaacgccactgtc
gccgccggtgcctccgtcgagttcgggatgatcgtgtccggcaccgggcggcccacgagc
tgcacggtgaacggctcggactgcggggtggcgacctcgccgacgacggtgccggcctcg
actgccccggcgaccacgaccccgaccagcaagccggccaccaccgcgcccaccaccaag
cccgcgaccaccgcgcccaccaccgcgccggcgacgaccgcgccgaccaccgcggccccg
gccaccggcaccccggtcggcatcaacggccagctgcacgtctgtggcgtcaacctgtgc
aaccagtacgacaaggcgatccagctacgcggcatgagcacgcacggcctgcagtggttc
cccgactgctacaccaacgcctcgctggacgcgctggccaacgactggaacgcggatctg
ctccggatcgccatgtacgtgcaggagggcggctacgagaccgacccgtccggcttcacc
ggcaaggtgaacacgctggtcgacatggccgaggcgcgcgggatgtacgcgctggtggac
tttcacacgctgaccccgggcgacccgaacgtcaacctggaccgggccaggacgttcttc
gccgcggtcgccaagcgcaacgccgcgaagaagaacgtcatctacgagatcgccaacgag
cccaacggggtcagctggaccgccgtcaagagctacgccgagcaggtcatcccggtgatc
cgggcgaacgacccggacgccgtggtcatcgtgggcacccgcggctggtcgtcactgggc
gtatcggacggctcgaactcgagcgaagtcatcgcgaacccggtcaaggcgagcaacatc
atgtacacgttccacttctacgcggcgtcgcacaaggacaactaccgcgctgaggtgcag
aaggcggccgcgtcgctaccgctgttcgtcaccgagttcggcacggtcagcgcgagcggc
gggggagcggtcgacaccgccggctccaccgcgtggctcgacctgctggacaagctgagg
atcagctacgccaactggacgttctccgacgcgaacgagggcagcgcggcgctcaagccg
ggcacctgtgccagcggctcgttcaccggcaccggggcgctgaccgagtcgggcgcgctg
atccgcagccggatccgtacggcggacaatttcccggtgggatga

DBGET integrated database retrieval system