KEGG   Actinoplanes sp. N902-109: L083_3701Help
Entry
L083_3701         CDS       T02655                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    L083_3701
Enzymes [BR:actn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     L083_3701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4402620..4403294
Genome map
AA seq 224 aa AA seqDB search
MAQLHYRHAAMNSGKSTMVLQYRHTYAACGRRGLLMTRLDRAGTGIVSSRIGLAADALEI
GAATDLTELVLDRPAPRVDHVIVDEAQFLAPEQVDQLATLVDDHDIDVFAFGLLSDFRGL
QFPGSARLVVLADIVEALQVYPMCWCGQPARMNARVVSGEMVRDGDTVVLGDTGADVGYV
VLCRRHHRAGRPYAPQPDPTTCGGPDPQPAVDQGRDHHLAAVAS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtggctcagctgcactatcggcatgcggcgatgaacagcggcaagagcaccatggtgctt
cagtaccggcacacgtacgccgcgtgcgggcggcgggggctgttgatgaccaggctggac
cgggccggcaccggcatagtgtcgtcgcgcatcgggttggccgcggacgcgctcgagatc
ggcgcggcgaccgacctcaccgagctcgtccttgaccggcccgcgccacgtgttgaccac
gtcatcgtcgacgaagctcaattcctggcgcccgaacaggtcgatcaactggcgacgttg
gtggatgaccacgacatcgacgtgttcgccttcggcctgctgtcggacttccgtggcctg
cagttcccggggtcggcacggctcgtggtgctggcggacatcgtcgaggcgttgcaggtg
tacccgatgtgctggtgcggccagccggcgcggatgaacgcccgggtggtcagcggcgag
atggtgcgcgacggcgacaccgtggtgctcggcgacaccggggccgacgtgggctacgtc
gtgctgtgccggcgccaccaccgggcgggccgcccgtacgccccgcagccggaccccacg
acgtgcggggggccggatccgcagcccgcggttgaccagggacgggatcaccatctggcg
gcggtcgcgagctga

DBGET integrated database retrieval system