KEGG   Actinoplanes sp. N902-109: L083_3893Help
Entry
L083_3893         CDS       T02655                                 

Definition
(GenBank) glucan endo-1,6-beta-glucosidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00511  Other glycan degradation
actn00600  Sphingolipid metabolism
actn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    L083_3893
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    L083_3893
Enzymes [BR:actn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     L083_3893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 F5_F8_type_C Glyco_hydro_30C Glyco_hydr_30_2 Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: AGL17403
UniProt: R4LGA5
Position
complement(4602489..4604342)
Genome map
AA seq 617 aa AA seqDB search
MAATALLLLAGAAPARAHPAPVPRARVWVTTPDRAEQLHERAPVAFRRGDSALTTITVDP
GTRYQSMDGFGASLTDSAAAVLYRLAPAQRDAAMRSLFDPRGGIGVSFLRQPVGSSDFTA
AAQHYSYDDVPAGRTDFALEHFSIDHDRARILPLLRRARQLDPQLTVLATPWSPPAWMKT
SDSLIGGHLKDDPRIYDAYARYLVRFVQEYAEAGVRIDYLTVQNEPQNRHDGGYPGTALP
VPQEAAVIEALGPKLAAAHLPTRILGYDHNWTTHPGDVATTPAGEDPETDYPYRLLAAPA
GKWLAGTAYHCYSGDPGAQSALHRAYPAKGIWFTECSGSHGAADTPEQIFRGTLTWHART
LAIGTTRNWAKSVVNWNIALDSTGGPHLGGCDTCTGLLTLQADGSVSRDAEYYTIGHLSK
FVRPGAVRIASTSYGTTGWNGQIMDVAFRNPDGSTALVVHNENDNPRSFAVAVGGRSFEY
TLPGGALATFTWPRSALPAASPVPVTSADPLLDGDGSTRWSSGAAQTPGQSVTADLGRPV
HFSRVAVDSGDNLGDYARSFSLAASGDGERWRPLGSFTARGQLTTVTVPPVSARYLRVTN
TSTGAGWWSIADLRLYR
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccaccgccttgctcctgctcgcgggcgccgcacccgcccgggcccaccccgcc
cccgtaccgcgggcgcgggtctgggtgaccacccccgaccgcgccgaacagctgcacgag
cgtgccccggtggccttccgccgcggcgacagcgcgctgaccacgatcacggtcgacccc
ggcacccgctaccagagcatggacggcttcggcgcctcgctgaccgactcggccgccgcg
gtgctgtaccggctggccccggcgcagcgcgacgccgccatgcgctcgctgttcgacccg
cgcggcggcatcggcgtcagcttcctgcgccagccggtcggctcgtcggacttcaccgcc
gccgcgcagcactacagctacgacgacgtcccggccgggcggaccgacttcgccctcgag
cacttcagcatcgaccacgaccgggcgcgcatcctgccgctgctgcgccgcgcgcgacag
ctcgacccgcagctgaccgtgctggccacaccgtggagccccccggcctggatgaagacc
agcgactcgctgatcggcgggcacctcaaggacgaccccaggatctacgacgcgtacgcc
cgctacctggtccggttcgtgcaggagtacgccgaggcgggcgtgcggatcgactacctg
accgtgcagaacgagccgcagaaccgccacgacggcggttaccccggcaccgcactgccc
gtgccgcaggaggccgcggtcatcgaggcgctcggcccgaagctcgccgccgcgcacctg
ccgaccaggatcctcgggtacgaccacaactggaccacgcaccccggtgacgtggcgacc
accccggcgggcgaggacccggagaccgactacccgtaccggctactcgccgcaccggcc
ggcaagtggctggccgggaccgcctaccactgctactccggcgaccccggcgcgcagagc
gccctgcaccgggcgtacccggccaaggggatctggttcaccgagtgctccggctcgcac
ggcgcggccgacacccccgagcagatcttccggggcacgctgacctggcacgcccgcacg
ctcgccatcgggacgacccgcaactgggccaagtcggtggtcaactggaacatcgccctg
gacagcaccggcggcccgcacctcggcggctgcgacacctgcaccgggctgctcacgctg
caggccgacggcagcgtctcgcgggacgccgagtactacacgatcgggcacctgtcgaag
ttcgtgcggcccggcgccgtccgcatcgccagcacgtcgtacggcaccaccggctggaac
ggccagatcatggacgtcgccttccgcaacccggacggctcgaccgcgctggtcgtgcac
aacgagaacgacaacccgcgctcgttcgccgtcgcggtgggcggccgctcgttcgagtac
accctgcccggcggcgccctggcgaccttcacctggccgcggtcggcgctgccggcggcc
tccccggtgccggtcacgtcggccgacccgctgctcgacggcgacggctcgacccgctgg
tccagcggcgccgcccagacaccgggtcagtcggtgaccgccgacctcggccgcccggtg
catttctcccgcgtcgccgtcgacagcggggacaacctcggcgactacgcgcgctcgttc
tcgctggcagcgagcggcgacggtgagcggtggcggccgctgggcagcttcaccgcccgc
ggtcagctgaccaccgtgaccgtgcccccggtcagcgcccgctacctgcgtgtcaccaac
acctcgaccggcgccggctggtggagcatcgccgatctgcggctgtaccgctga

DBGET integrated database retrieval system