KEGG   Actinoplanes sp. N902-109: L083_4283Help
Entry
L083_4283         CDS       T02655                                 

Definition
(GenBank) L-amino-acid oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00260  Glycine, serine and threonine metabolism
actn00330  Arginine and proline metabolism
actn00340  Histidine metabolism
actn00350  Tyrosine metabolism
actn00360  Phenylalanine metabolism
actn00380  Tryptophan metabolism
actn01100  Metabolic pathways
actn01110  Biosynthesis of secondary metabolites
Module
actn_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    L083_4283
   00330 Arginine and proline metabolism
    L083_4283
   00340 Histidine metabolism
    L083_4283
   00350 Tyrosine metabolism
    L083_4283
   00360 Phenylalanine metabolism
    L083_4283
   00380 Tryptophan metabolism
    L083_4283
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     L083_4283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 Pyr_redox_2 DAO FAD_binding_3 Thi4 FAD_oxidored HI0933_like AlaDh_PNT_C Pyr_redox Pyr_redox_3 GIDA
Motif
Other DBs
NCBI-ProteinID: AGL17793
UniProt: R4LHA8
Position
complement(4996973..4998562)
Genome map
AA seq 529 aa AA seqDB search
MSDRDVSRRRFLQSVGVSGGAGALFATMGALGLAPAAASPAPAFRAPSSSDFHLSGRSAK
RVVILGGGIAGLASAYELGKAGYDCTVLEARGVAGGRNFTVRGGTTETDLDGHTQRATFS
PGVYLNAGPARLAQWMITLDYCRELGVPIEVFTNQNADAYLYNEASGVAPQRYRTAKADV
YGYVSELLAKATDQGALDGMLTAEDKERVLTFLQGFGAIGGRTDDWAYAGTTRRGFASYP
GAGNDAGTPLPGPPALADVFATAVGRYFSFEFGYDQAMLMFQPVGGMDRIPYALSRAVGP
ARIKLGAEVTGVTDRPGGVQVTYTRGGRSHAITADFCIAALPPHLLARIPHNLGDAVTAA
LGSFPVTASGKIGLEYRRRWWEQDLNIYGGITETDLDIAHIWYPSYGYHGDRGLIVGYYN
TGAAARTYGSLTPPERLERALAQGAKIHGETYRKDLAASFSMAWHRTRYLEGAWTSPPTG
TPAYNLLLQPAGHVYFAGDWLSHEVAWQHGAFVSARSVVTALHQRVMTH
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgatcgtgatgtgagccgccggcggttcctgcagtccgtgggggtcagcggcggt
gccggggcgttgttcgccaccatgggtgcgctggggctggcgccggccgccgcatccccg
gcaccggcgttccgggcgcccagcagctccgacttccacctgtccgggcgcagcgcgaag
cgcgtggtgatcctgggcggtggcatcgccgggctggcttcggcgtacgagctgggcaag
gcgggttacgactgcacggtgctggaggcgcgcggggtggccggcgggcgcaacttcacc
gtgcgcggcggcaccaccgagaccgacctggacgggcacacccagcgggccacgttctcg
ccgggcgtctacctcaacgccgggccggcgcggctggcgcagtggatgatcaccctcgac
tactgccgtgagctgggcgtgcccatcgaggtgttcaccaaccagaacgccgacgcctac
ctctacaacgaggcgtccggggtggcgccgcagcgctaccgcacagcgaaggccgacgtg
tacggctatgtctccgagctgctcgccaaggccaccgaccagggcgccctcgacggcatg
ctgaccgccgaggacaaggagcgggtgctcaccttcctgcagggcttcggtgcgatcggt
ggccgtaccgacgactgggcctatgccggcaccacccggcgcggtttcgcgagctacccg
ggcgcgggcaacgacgccggtacgccgctgcccggaccgcccgcgctggccgacgtgttc
gccaccgccgtcgggcgctatttcagcttcgagttcggctacgaccaggccatgctgatg
ttccagccggtcggcgggatggaccggatcccgtacgcactgagcagagccgtcgggccc
gcccggatcaagctgggcgccgaggtgaccggcgtgaccgaccggcccggcggcgtccag
gtgacctacacccggggcgggcgcagccatgcgatcaccgcggacttctgcatcgccgcg
ctcccgccgcacctgctcgcccgcatcccgcacaacctgggcgacgccgtcacggccgcg
ctgggctcgttcccggtcaccgcgtccggcaagatcgggctggagtaccggcgccgctgg
tgggagcaggacctgaacatctacggcggcatcaccgagaccgacctggacatcgcgcac
atctggtacccgtcgtacggctaccacggtgaccgcgggctgatcgtgggctactacaac
accggtgcggcggcccgtacgtacggctcgctcaccccgcccgaacgcctcgaacgggcg
ctcgcgcagggggcgaagatccacggggagacgtaccgcaaggacctggccgcgtcgttc
tcgatggcctggcaccgcacgcgctatctggagggtgcgtggaccagcccgcccaccggc
accccggcctacaacctgctgctgcaaccggccggccacgtgtacttcgcgggcgactgg
ctcagccatgaggtcgcctggcagcacggcgccttcgtctcggcccggtcggtggtgacg
gctctgcaccagcgggtcatgacgcactga

DBGET integrated database retrieval system