KEGG   Actinoplanes sp. N902-109: L083_5016Help
Entry
L083_5016         CDS       T02655                                 

Gene name
ybhC
Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    L083_5016 (ybhC)
   00500 Starch and sucrose metabolism
    L083_5016 (ybhC)
Enzymes [BR:actn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     L083_5016 (ybhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5779648..5780088
Genome map
AA seq 146 aa AA seqDB search
MRDSYIEGDTDFVFGRASAVFDHTHFHLVSTRKPSGGIVFAPNTAPHYPYGFLVTHSLLP
TDAGYLATPTGLFGRSWDQGAGTTGYLPGTTPDEQLVIRDTRIGAGFNETAPWAPAATTG
RPFTASTEPGRDLDDVDANRLWEAAH
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgacagctacatcgagggcgacaccgacttcgtcttcggccgagccagcgcggtc
ttcgaccacacccacttccacctggtctcgacccgcaaacccagcggcggcatcgtcttc
gcccccaacaccgcaccccactatccgtacggcttcctggtcacccattcgctgctgccc
acggacgcgggctacctggccaccccgaccggcttattcgggcgctcgtgggaccagggc
gccggcaccaccggctacctccccggcaccacccccgacgagcagctggtcatccgggac
acccgcatcggcgcgggcttcaacgagacggcaccctgggcccccgccgcgaccaccggc
cgcccattcaccgcctcgaccgaaccgggccgcgatctcgacgacgtcgacgcgaaccgg
ctctgggaggccgcacactga

DBGET integrated database retrieval system