KEGG   Actinoplanes sp. N902-109: L083_5208Help
Entry
L083_5208         CDS       T02655                                 

Gene name
glgB
Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L083_5208 (glgB)
Enzymes [BR:actn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     L083_5208 (glgB)
Exosome [BR:actn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L083_5208 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5972254..5974416
Genome map
AA seq 720 aa AA seqDB search
MIGQTASTPSLAGDQRLLSAVISGDTHDPHALLGTHPTGKDKTVIRTMRKGAEAVAIVVG
DERTEMEQVHPDGIFAVELPGTVLDYRLDVDGTVCDDPYRHLPTLGELDLHLIGEGRHEK
LWTVLGAHPRGTGVAFAVWAPAARGVQVIGDFTGWGPYDGWPMRSLGSSGVWELYVPAAA
AGQKYKFKILGRDGVWREKADPLAQHTEVPPATASVVYESSYEWQDAAWMTGRAAKEWHQ
EPMSAYEVHLGSWRPGLSYTELAEQLVDYVKETGFTHVELMPVMEHPFGGSWGYQVTGYF
APTSRFGSPDEFRYLVDKLHQADIGVILDWVPAHFPKDEWALARFDGTPLYEHGDWRRGE
QPDWGTYVFDFGRKEVRNFLVANALYWCEEFHADGLRVDAVASMLYLDYSRKDGEWAPNQ
YGGRENLEAISFLQEMNATVYRHNPGVMTIAEESTAWPGVTRPTHLGGLGFGFKWNMGWM
NDTLSYMEKEPIHRQWHHHQMTFATVYAWSENYILPISHDEVVHGKGSLTGKMPGDRWQK
LANTRALLGFMWAFTGKQLLFMGAEMGDEREWSEERGLDWDLVAQDTEGAGIQQLVKDLN
RAYRETPAIWTQDTEPSGFRWITSEDSQHNTFSFLRFAPNGDTFACIVNFAAVPHDGYRI
GLPRPGVWREIINTDSTTYGGSGVGNLGEVHAEELPWHGLNASASLRVPPLGAVWLRFEG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacagaccgcgtccacgccctccctggccggggaccagcgcctgctcagtgcc
gtcatctcgggcgacacccacgacccgcacgcgctgctcggcacgcaccccaccggcaag
gacaagaccgtcatccgcacgatgcgcaagggcgccgaggcggtcgcgatcgttgtcggc
gacgagcggaccgagatggagcaggtccacccggacggcatcttcgccgtcgagctgccc
ggtacggtgctcgactaccgcctcgacgtggacggcacggtgtgcgacgacccgtaccgg
cacctgcccacgctcggcgagctcgacctgcacctgatcggcgagggccggcacgagaag
ctgtggacggtgctcggcgcccatccccgcggcaccggggtggcgttcgccgtgtgggca
cccgccgcccggggcgtgcaggtgatcggcgacttcaccgggtggggtccgtacgacggc
tggccgatgcgctcgctgggcagcagcggcgtctgggagctgtacgtccccgccgccgcg
gccggccagaagtacaagttcaagatcctcggccgcgacggggtgtggcgcgagaaggcc
gacccgctggcccagcacaccgaggtgccgccggccaccgcgtcggtcgtctacgagtcg
tcgtacgagtggcaggacgccgcctggatgaccgggcgggccgccaaggagtggcaccag
gagccgatgagtgcgtacgaggtgcacctcggctcgtggcggcccgggctgtcctacacc
gagctggccgagcagctggtcgactatgtcaaggagaccggcttcacccacgtcgagctg
atgcccgtcatggagcacccgttcggcggttcctggggctaccaggtcaccggctacttc
gcgccgacgtcccggttcggctcccccgacgagttccgctacctggtggacaagctgcac
caggcggacatcggcgtgatcctcgactgggtgccggcgcacttccccaaggacgagtgg
gcgctggcgcgcttcgacggcaccccgctgtacgagcacggcgactggcggcgcggcgag
cagcccgactggggcacgtacgtgttcgacttcggccgcaaggaggtccgcaatttcctg
gtggccaacgcgctctactggtgcgaggagttccacgccgacgggctgcgggtcgacgcg
gtcgcctcgatgctctacctcgactactcgcgcaaggacggcgagtgggcgcccaaccag
tacggcggccgggagaacctcgaggcgatcagcttcctgcaggagatgaacgcgacggtc
taccggcacaaccccggcgtgatgaccatcgccgaggagtccaccgcgtggcccggcgtc
acccgccccacccacctcggcgggctgggcttcggcttcaagtggaacatgggctggatg
aacgacaccctgtcgtacatggagaaggagcccatccaccggcagtggcaccaccaccag
atgaccttcgccaccgtgtacgcctggagcgagaactacatcctgccgatcagccacgac
gaggtggtgcacggcaagggctcgctcaccggcaagatgcccggcgaccgctggcagaag
ctggccaacacccgcgccctgctcggcttcatgtgggccttcaccggcaagcagctgctg
ttcatgggcgccgagatgggcgacgagcgggagtggagcgaggaacgcggcctggactgg
gacctggtcgcccaggacaccgagggcgcgggcatccagcagctcgtcaaggacctcaac
cgggcctaccgcgagacccccgccatctggacccaggacaccgagcccagcggcttccgc
tggatcacctcggaggactcgcagcacaacacgttctcgttcctccgcttcgcccccaac
ggcgacaccttcgcctgcatcgtcaacttcgccgcggtcccgcacgacggctaccgcatc
ggcctgccccgccccggggtctggcgcgagatcatcaacaccgactccaccacgtacggc
ggatccggggtgggcaacctcggtgaggtgcacgccgaggaactgccctggcacgggctg
aacgcctccgcgtcgctgcgcgtcccgccgctcggcgcggtgtggttgcgcttcgagggc
tga

DBGET integrated database retrieval system