KEGG   Actinoplanes sp. N902-109: L083_5578Help
Entry
L083_5578         CDS       T02655                                 

Definition
bifunctional pectate lyase/pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    L083_5578
   00500 Starch and sucrose metabolism
    L083_5578
Enzymes [BR:actn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     L083_5578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6410012..6411220)
Genome map
AA seq 402 aa AA seqDB search
MSFRTNTVRLSACPAAGGLAAVVLLSLSAAAPAAAAPAAAAPAGAAGPGAAAALTAAAPA
GAAAPAGAAAPAAAASASARAALATTITVAADGSGNYTTVQAAINSVAANNTTAVTINIK
PGTYRGVVTIPANKPYLTLAGTGSSPSQVVIVEGHAAGMANPSGGTYGTSGSASVFVNAN
DTLIKNVTMSNDFNEAAYTLDGEQAVAVNTSGDRVQFDNVRILGNQDTLLVNAPSASAVR
RLYVRNSYVEGDVDFIFGRGTMVFQNGTIHSLTRGSSSNNGYITAAATDINNKFGYLIWG
TTLTSNAPAKTVYLGRPWHPSNDVNARGQVLYRGVTMGAHIRDDAWTDMSGFSWKDARFS
EYSSTGAGAVVNANRPQMSATTAAQYVPTAYLAGSDGWNPIH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttcgtaccaacaccgtccgtttgtccgcgtgtccggcggctggtgggctggct
gccgttgtcctgctctcgctgagcgctgccgcgccggctgccgccgcgcctgctgccgcc
gcgcctgctggtgccgcggggccgggtgctgctgccgcgctgactgctgccgcgcctgct
ggtgctgccgcgcctgctggtgctgccgcgccggctgctgctgcgtcggcgtcggctcgg
gctgcgctggccaccacgatcaccgttgccgccgacggcagtggcaactacacgactgtg
caagccgcaatcaacagtgttgctgcgaacaacacgactgccgtgacgatcaacatcaag
ccgggcacctaccgcggggtggtcaccatcccggccaacaagccgtacctcacactcgcc
ggcaccggcagttcgccgagccaggtcgtgatcgtcgaggggcacgcggccggcatggcc
aaccccagcggcggcacgtacggcacctcgggcagcgcctccgtcttcgtcaacgcgaac
gacaccctcatcaagaacgtgacgatgtccaacgacttcaacgaggcggcgtacaccctc
gacggcgaacaggccgttgccgtcaacacgtccggcgaccgggtgcagttcgacaacgtc
cgcatcctcggcaaccaggacaccctgctggtcaacgcgcccagcgccagcgccgtacgg
cggctctatgtgcgcaactcgtacgtggaaggcgatgtcgacttcatcttcggccgcggc
accatggtgttccagaacggcacgatccactcgctgacccgcggatcgtcgtcgaacaac
ggctacatcaccgcggcggccaccgacatcaacaacaagttcggctacctcatctggggc
accacgctcaccagcaacgccccggcgaagacggtgtacctgggccggccctggcacccg
agcaacgacgtcaacgcccgcggtcaggtgctgtaccgcggcgtcaccatgggcgcgcac
atccgcgacgacgcctggacggacatgtccggcttctcgtggaaggacgcccgcttctcc
gagtacagcagcaccggcgcgggcgccgtcgtcaacgccaaccggccgcagatgagcgct
acgaccgccgcccagtacgtgccgaccgcttatctggcgggcagcgacggctggaacccc
atccactga

DBGET integrated database retrieval system