KEGG   Actinoplanes sp. N902-109: L083_5602Help
Entry
L083_5602         CDS       T02655                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
actn  Actinoplanes sp. N902-109
Brite
Enzymes [BR:actn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     L083_5602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6440729..6442144)
Genome map
AA seq 471 aa AA seqDB search
MRPLFGGVVAAVTALGIGVAMPDANAAASTLGAAAAQSGRYFGTAIAAGRLGDSTYSTIA
GREFNMVTAENEMKPDATEPQRGQFNFSSGDQIYNWATQRGMKVRGHTLAWHAQQPSWWG
SLSGSALRQAMVDHINGVMAHYKGKLAYWDVVNEAYAENGSRRSSNLQSTGNDWIEVAFR
TARAADPSVKLCYNDYNIENWTYAKTQGVYNMIKDFKSRGVPIDCVGLQTHFTGGSSLPS
NFQTTLSSFAALGVDVALTEVDVTNASTSQYAGLTQACMNVSRCVGITVWGVRDSDSWRS
SENPLLFDGSGNKKAAYTSVLNALNAGGSGGPTSPPPSGTTPPPSSGDAKRILGAQSGRC
IDVPNASQSNGTRVQLYDCNGQSNQAWTQSSTNQLTVYGTMCLDAAGTANGSAVQIYSCN
GQANQQWTVTSSGTITNGQSGRCLDVWGTGNGQQVQIYDCNGQANQRFTLS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccctgttcggcggcgtcgtcgccgccgtcacggccctgggaataggcgtggcg
atgcccgacgcgaacgccgcggcgagcaccctgggggcggcggccgcacagtcgggccgg
tatttcggcacggccatcgcggcgggccggctcggtgactcgacctacagcaccatcgcc
ggccgtgagttcaacatggtcaccgccgagaacgagatgaagccggacgccaccgaaccg
cagcgtggccagttcaacttcagctcgggcgaccagatctacaactgggcgacccagcgc
ggcatgaaggtgcgcggccacaccctggcctggcacgcccagcagccgagctggtggggg
agcctgagcggcagcgcgctgcgccaggcgatggtcgaccacatcaacggcgtgatggcc
cactacaagggcaagctggcgtattgggacgtggtcaacgaggcctacgcggagaacggc
agccggcgctcgtccaacctgcagtcgaccggcaacgactggatcgaggtggcgttccgc
acggcgcgcgccgccgacccgtcggtcaagctctgttacaacgactacaacatcgagaac
tggacgtacgccaagacgcagggcgtctacaacatgatcaaggacttcaagtcccggggc
gtgccgatcgactgtgtgggcctgcagacccacttcaccgggggcagttcgctgcccagc
aacttccagaccacgctgtcgagcttcgcggcgctgggcgtggacgtggcgctgaccgag
gtcgacgtcaccaacgcctcgacctcgcagtacgccgggctcacccaggcgtgcatgaac
gtctcccgctgcgtcggcatcaccgtgtggggcgtgcgcgacagcgactcgtggcgctcc
agcgagaacccgctgctgttcgacggctccggcaacaagaaggcggcgtacacctcggtg
ctcaacgccctcaacgccggtggcagcggcggacccacctcgccgccgccgagtggcacc
acgccgccgccctcgtcgggtgacgccaagcggatcctgggcgcccagtccggccggtgc
atcgacgtgccgaacgcctcgcagagcaacggcacccgggtgcagctctacgactgcaac
ggtcagagcaaccaggcctggacgcagagctcgaccaaccagctgaccgtgtacggcacc
atgtgcctcgacgcggccggcaccgccaacggctcggccgtgcagatctacagctgcaac
gggcaggccaaccagcagtggacggtcacctccagcggcaccatcaccaacggccagtcc
gggcgctgcctcgacgtctggggcaccggcaacggccagcaggtgcagatctacgactgc
aacggccaggcgaaccagcggttcaccctgagctga

DBGET integrated database retrieval system