KEGG   Actinoplanes sp. N902-109: L083_5620Help
Entry
L083_5620         CDS       T02655                                 

Definition
1,4-beta cellobiohydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L083_5620
Enzymes [BR:actn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     L083_5620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6457881..6459068
Genome map
AA seq 395 aa AA seqDB search
MAVTSAPAAATIADGTRFYTPRPDPGAVQQIAELKAAGQRVLAHQIRVMTETPQAVWVTG
GAGSSLTASVRTEARRAAATRTMPVFVAYNIPFRDCSQYSAGGATSVAEYKAWVDAFAAG
IGSRKAAVLLEPDGLGIIPWYTTINGSQEWCQPAEADAATAAADRFAMLNYAVNRFKALP
RTSVYLDGTHSAWLGVGDIADRLVKAGVRKADGFFLNVSNYETTERQLKFGDWISKCVYY
GTQGPAEARGHFEQCASQYYPASPNDFSTWALSDAWYADNVGQVSPHRLAHFVVDTSRNG
QGPWTAPAGVTWPDPQTWCNPPDRGLGLRPTTRTGDPLADALLWVKTPGQSDGQCDRGTG
TGTDPARGGIADPAAGAWFPQQAEELVRLANPPLR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttggcggtcacgtccgcacccgcagccgccaccatcgccgacggcacccgcttctacacc
ccgcgccccgacccgggcgccgtccagcagatcgccgagctcaaagccgccggccagcgt
gtcctcgcgcaccagatccgggtcatgaccgagaccccgcaggcggtgtgggtcaccggc
ggcgccggtagctcgctgaccgcctcggtgcgcaccgaggcgcggcgcgcggccgcgacc
cggacgatgccggtcttcgtcgcctacaacatcccgttccgggactgctcgcagtactcc
gccgggggtgccacctcggtggcggagtacaaggcgtgggtcgacgccttcgcggccggg
atcggcagccggaaagcggcggtcctgctcgaaccggacgggctgggcatcatcccctgg
tacaccacgatcaacggcagccaggagtggtgccagccggccgaggcggacgccgccacc
gcggccgccgaccggttcgcgatgctcaactacgcggtgaaccggttcaaggccctgccc
cgcaccagcgtctatctcgacggcacccacagcgcctggctcggcgtcggtgacatcgcc
gaccgcctggtcaaggccggtgtacgcaaggccgacggcttcttcctcaacgtgtcgaac
tacgagaccaccgagcgccagctcaagttcggcgactggatctcgaagtgtgtctactac
ggcacgcaggggccggccgaggcccgcggccacttcgagcagtgcgccagtcagtactac
ccggccagcccgaacgacttcagcacctgggcgctgagcgatgcctggtacgccgacaat
gtcggtcaggtgtcgccgcaccggctggcgcacttcgtggtggacaccagccgcaacggg
cagggcccgtggaccgcacccgccggcgtgacctggccggacccgcagacctggtgcaac
ccgccggaccgcggtctcggcctgcggcccaccacccgcaccggcgatccgctggccgac
gccctgctctgggtgaagacgccggggcagtccgacggtcagtgcgaccgcggcaccggc
accggcaccgacccggctcgcggcggcatcgccgatccggcggccggcgcctggttcccg
cagcaggccgaggaactggtccggctggcgaacccgccgctgcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system