KEGG   Actinoplanes sp. N902-109: L083_6637Help
Entry
L083_6637         CDS       T02655                                 

Definition
PfkB domain protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    L083_6637
Enzymes [BR:actn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     L083_6637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7596493..7597392
Genome map
AA seq 299 aa AA seqDB search
MKPPVAVVVGQIARDLVLSVATAPEAGVAADASDRREQLGGKGANQAVGLAQLGVRPKLL
AVAGDDVIGDVLIAQAQSDGIDTAAVIRRRGTLTGLIVEVLDDDGKWRYVQHLPEPVLLT
EADVRGAREVIASADAVLVQLQQPAAAAQAAAEIGRQAGALVVLDGVPQDAHLAAADVLR
ADEQEAKLLLDDDPSADKARALLAKGPRLLALGVPDGNLFVWSDGHLHLPLTSETVVDTT
GGGDAFTAALTAALLRGEDYPTAARWAVSASGATVGHPSGRPQLHTEELQKRVRELAGG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccaccggtagccgtcgtagtcggacaaatagcccgcgatctcgtcctgtccgtg
gccaccgccccggaggccggcgtcgccgccgacgcgagcgaccgccgggaacagctcggc
ggcaagggtgccaaccaggcggtcggtctggcccagctgggggtacgccccaagctgctc
gccgtcgccggggacgacgtgatcggcgacgtgctgatcgcccaggcccagtccgacggg
atcgacaccgccgcggtgatccgccgccggggcaccctgaccggcctgatcgtcgaagtg
ctcgacgacgacggcaagtggcggtacgtgcagcacctgcccgagccggtgctgctgacc
gaggcggacgtgcgtggtgcccgggaggtcatcgcgagtgcggacgctgtgctcgtacag
ctgcaacagccggcggcagcggcacaggccgcagcggagatcggccggcaggccggggcc
ctggtcgtgctcgacggggtgccgcaggacgcccacctggccgccgccgatgtgctgcgc
gccgacgagcaggaggcgaagttgctgctcgacgacgatccgagcgccgacaaggcccgg
gcactgctggccaaaggaccccgcctgctcgcgctgggcgtcccggacggcaacctcttc
gtctggtcggacgggcacctgcacctgccgctgaccagcgagacggtggtcgacacgacc
ggcggcggggacgccttcacggcggcgctgaccgcggccctgctgcgcggcgaggactac
cccacggcggcccgctgggcggtgtcggcctccggtgccaccgtgggacacccgagcggg
cgcccccagctgcacaccgaggagctgcagaagcgggtgcgggagctggccggtgggtga

DBGET integrated database retrieval system