KEGG   Actinoplanes sp. N902-109: L083_6660Help
Entry
L083_6660         CDS       T02655                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:actn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7618474..7619880
Genome map
AA seq 468 aa AA seqDB search
METVRKRVAVIGGGIAGLAAAVRLRDRAPSDTEIIVYEQSGRLGGKLRTGELAGTRVERG
AESMLMSGPDGGESAAVRFARRLGFGDTLMHPAPIPAALAIGGSLERVPAGTLVGVPGDL
SLLGTVAQPAVGADRDEGHPLLADGADIAVGELVRARYGDQVADRLVDPMLGGVYAGHAD
RLSLATTMPALARTARTEHTLQGAVRAAQAATVRVPGRPVFAAPAGGMSSLIGAAAAASG
ARISLGLPVREIMPTAHGWRLLLGPVPAPQIDDVDAVVLAVPAAPAARMLSGVDLSAAAT
IELLDYASVALAAFAFPAGTELPELSGFLVPPGEGTLVKAATFITRKWPGLDRPDGPVVV
RVSLGRAGEEERLQFDDAVLTATAHAELGRLLGRELPAPVGSWLQRWGGGLPQYAPGHLD
RIALARAALSEHPGLALAGAAYDGVGLPACVASGEKAADDVLKHLEER
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtggagaccgtgcgaaagcgggtagcggtcatcggcggaggcatcgccgggctcgctgcg
gccgtccggctgcgcgaccgggccccctccgacaccgagatcatcgtgtacgaacagagc
ggccgcctcggtggcaagctgcgcaccggcgagctcgcgggcacccgggtggagcggggc
gccgagtccatgctgatgagtggccccgacggcggcgagtccgcggcggtccggttcgcc
cggcggctcgggttcggcgacacgctgatgcacccggcgcccatcccggccgccctggcc
atcggtggctcgctcgagcgggtcccggccggcacgctggtcggggtcccgggtgacctg
tccctgctcggcaccgtggcgcaacccgccgttggcgccgaccgggacgagggccacccg
ctgctcgccgacggtgccgacatcgccgtgggtgagctggtccgcgcccgctacggcgac
caggtcgccgaccgcctcgtcgacccgatgctgggcggggtctacgccggccacgccgac
cggctctcgctggccaccaccatgcccgcgctggctcgcaccgcccgcaccgagcacacc
ctgcagggggccgtgcgcgccgcgcaggccgccaccgtgcgggtgccgggccgcccggtc
ttcgccgcgccggccggcggcatgagcagcctgatcggcgcggccgccgccgccagcggg
gcccggatcagcctgggcctgccggtgcgcgagatcatgccgaccgcgcacggctggcgg
ctgctgctgggcccggtgcccgcgccgcagatcgacgacgtcgacgccgtggtgctggcc
gtgcccgccgccccggccgcacgcatgctgtccggggtggacctgtccgccgccgccacg
atcgagctgctcgactacgcctcggtggcgctcgccgcgttcgccttcccggccggcacc
gagctgcccgagctctccggcttcctggtgccgccgggcgagggcaccctggtcaaggcc
gcgaccttcatcacccgcaagtggcccggcctcgaccggcccgacggcccggtggtggta
cgggtctcgctcggccgggccggtgaggaggagcggctgcagttcgacgacgccgtgctc
accgccaccgcgcatgccgagctgggccggctcctcggccgcgagctgcccgccccggtc
gggtcctggctccagcgctggggcggcggcctgccgcagtacgctcccggccacctcgac
cgcatcgcgctggcccgcgcggcgctgagcgagcaccccggtctcgcgctggccggcgcc
gcctacgacggcgtgggcctgccggcctgcgtggccagcggcgagaaggccgccgacgac
gtcctgaaacacctggaggaacgatga

DBGET integrated database retrieval system