KEGG   Actinoplanes sp. N902-109: L083_6660Help
Entry
L083_6660         CDS       T02655                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00860  Porphyrin and chlorophyll metabolism
actn01100  Metabolic pathways
actn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    L083_6660 (hemG)
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     L083_6660 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     L083_6660 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 FAD_binding_2 Pyr_redox_2 HI0933_like MCRA FAD_oxidored Thi4 GIDA AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGL20170
UniProt: R4LY39
Position
7618474..7619880
Genome map
AA seq 468 aa AA seqDB search
METVRKRVAVIGGGIAGLAAAVRLRDRAPSDTEIIVYEQSGRLGGKLRTGELAGTRVERG
AESMLMSGPDGGESAAVRFARRLGFGDTLMHPAPIPAALAIGGSLERVPAGTLVGVPGDL
SLLGTVAQPAVGADRDEGHPLLADGADIAVGELVRARYGDQVADRLVDPMLGGVYAGHAD
RLSLATTMPALARTARTEHTLQGAVRAAQAATVRVPGRPVFAAPAGGMSSLIGAAAAASG
ARISLGLPVREIMPTAHGWRLLLGPVPAPQIDDVDAVVLAVPAAPAARMLSGVDLSAAAT
IELLDYASVALAAFAFPAGTELPELSGFLVPPGEGTLVKAATFITRKWPGLDRPDGPVVV
RVSLGRAGEEERLQFDDAVLTATAHAELGRLLGRELPAPVGSWLQRWGGGLPQYAPGHLD
RIALARAALSEHPGLALAGAAYDGVGLPACVASGEKAADDVLKHLEER
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtggagaccgtgcgaaagcgggtagcggtcatcggcggaggcatcgccgggctcgctgcg
gccgtccggctgcgcgaccgggccccctccgacaccgagatcatcgtgtacgaacagagc
ggccgcctcggtggcaagctgcgcaccggcgagctcgcgggcacccgggtggagcggggc
gccgagtccatgctgatgagtggccccgacggcggcgagtccgcggcggtccggttcgcc
cggcggctcgggttcggcgacacgctgatgcacccggcgcccatcccggccgccctggcc
atcggtggctcgctcgagcgggtcccggccggcacgctggtcggggtcccgggtgacctg
tccctgctcggcaccgtggcgcaacccgccgttggcgccgaccgggacgagggccacccg
ctgctcgccgacggtgccgacatcgccgtgggtgagctggtccgcgcccgctacggcgac
caggtcgccgaccgcctcgtcgacccgatgctgggcggggtctacgccggccacgccgac
cggctctcgctggccaccaccatgcccgcgctggctcgcaccgcccgcaccgagcacacc
ctgcagggggccgtgcgcgccgcgcaggccgccaccgtgcgggtgccgggccgcccggtc
ttcgccgcgccggccggcggcatgagcagcctgatcggcgcggccgccgccgccagcggg
gcccggatcagcctgggcctgccggtgcgcgagatcatgccgaccgcgcacggctggcgg
ctgctgctgggcccggtgcccgcgccgcagatcgacgacgtcgacgccgtggtgctggcc
gtgcccgccgccccggccgcacgcatgctgtccggggtggacctgtccgccgccgccacg
atcgagctgctcgactacgcctcggtggcgctcgccgcgttcgccttcccggccggcacc
gagctgcccgagctctccggcttcctggtgccgccgggcgagggcaccctggtcaaggcc
gcgaccttcatcacccgcaagtggcccggcctcgaccggcccgacggcccggtggtggta
cgggtctcgctcggccgggccggtgaggaggagcggctgcagttcgacgacgccgtgctc
accgccaccgcgcatgccgagctgggccggctcctcggccgcgagctgcccgccccggtc
gggtcctggctccagcgctggggcggcggcctgccgcagtacgctcccggccacctcgac
cgcatcgcgctggcccgcgcggcgctgagcgagcaccccggtctcgcgctggccggcgcc
gcctacgacggcgtgggcctgccggcctgcgtggccagcggcgagaaggccgccgacgac
gtcctgaaacacctggaggaacgatga

DBGET integrated database retrieval system